Klonierung, Überexpression, Reinigung und teilweise

Werbung
Klonierung, Überexpression, Reinigung und teilweise
Charakterisierung der ADP-Ribosyltransferasen ModA und
ModB des Bakteriophagen T4
Dissertation zur Erlangung des Grades
eines Doktors der Naturwissenschaften
der Fakultät für Biologie
der Ruhr-Universität Bochum
Angefertigt im Lehrstuhl der Biologie der Mikroorganismen/
Arbeitsgruppe Molekulare Genetik
Vorgelegt von:
Bernd Tiemann
aus Dortmund
Bochum
(1999)
Klonierung, Überexpression, Reinigung und teilweise
Charakterisierung der ADP-Ribosyltransferasen ModA und
ModB des Bakteriophagen T4
Dissertation zur Erlangung des Grades
eines Doktors der Naturwissenschaften
der Fakultät für Biologie
der Ruhr-Universität Bochum
Angefertigt im Lehrstuhl der Biologie der Mikroorganismen/
Arbeitsgruppe Molekulare Genetik
Vorgelegt von:
Bernd Tiemann
aus Dortmund
Bochum
(1999)
meinen Eltern
Danksagung
Mein besonderer Dank gilt meinem Doktorvater Herrn Prof. Dr. W. Rüger für sein
Interesse am Fortgang dieser Arbeit, der ständigen Diskussionsbereitschaft und seinen
wissenschaftlichen Anregungen, die diese Arbeit voran brachten.
Herrn Prof. Dr. M. Rögner danke ich für die Übernahme des Korreferats.
Danken möchte auch Herrn Prof. Dr. W. Klipp, an dessen Lehrstuhl diese Arbeit
angefertigt wurde.
Allen Mitarbeitern aus unserer Arbeitsgruppe Molekulare Genetik und des Lehrstuhls für
Biologie der Mikroorganismen danke ich für das ausgezeichnete Arbeitsklima und ihre
Unterstützung bei der Beschaffung diverser Vektoren und Bakterienstämme. Ganz
besonders danke ich Frau Ursula Aschke-Sonnenborn für ihre ständige Hilfsbereitschaft
und
Herrn
Heiko
Koch,
jetzt
auch
mit
„Dr.“,
für
seine
unermüdliche
Diskussionsbereitschaft und die etlichen Hinweise auf den Bommerholzer Wasserturm.
Abschließend möchte ich noch meinen Eltern danken, ohne deren Unterstützung weder das
Studium noch die Dissertation möglich gewesen wären.
Inhaltsverzeichnis
Inhaltsverzeichnis
Abkürzungsverzeichnis................................................................................................................ V
1
Einleitung......................................................................................................................... 1
1.1
Der Bakteriophage T4....................................................................................................... 1
1.1.1
1.2
ADP-Ribosyltransferasen.................................................................................................. 4
1.2.1
1.3
2
Die Genexpression des Bakteriophagen T4............................................................. 3
Die ADP-Ribosyltransferasen des Bakteriophagen T4 ........................................... 7
Aufgabenstellung ............................................................................................................ 12
Material und Methoden................................................................................................ 13
2.1
Geräteliste ....................................................................................................................... 13
2.2
Elektronische Datenverarbeitung.................................................................................... 14
2.3
Chemikalien und Verbrauchsmaterialien........................................................................ 14
2.4
Biologisches Material ..................................................................................................... 15
2.4.1
Plasmide ................................................................................................................ 15
2.4.2
Oligonukleotide (Primer)....................................................................................... 17
2.4.3
Bakterienstämme ................................................................................................... 18
2.4.4
Bakteriophagen...................................................................................................... 18
2.5
Arbeiten mit Bakterien.................................................................................................... 19
2.5.1
Anzucht von Bakterien .......................................................................................... 19
2.5.2
Transformation in Escherichia coli ....................................................................... 21
2.5.2.1
Herstellung kompetenter Zellen für die Elektrotransformation ..................... 21
2.5.2.2
Elektrotransformation..................................................................................... 21
2.5.2.3
Herstellung hitzeschockkompetenter Zellen mittels CaCl2 ............................ 21
2.5.2.4
Hitzeschocktransformation............................................................................. 22
2.5.3
Überexpression von Proteinen in Escherichia coli................................................ 22
2.5.3.1
Überexpression mit λ-Phage CE6 .................................................................. 22
2.5.3.2
Überexpression mit M13-Phage mGP1-2 ...................................................... 23
2.5.3.3
Überexpression mit DE3 Stämmen ................................................................ 23
2.5.3.4
Überexpression aus pBAD-Vektoren ............................................................. 24
2.5.3.5
Überexpression in Gegenwart von Bakteriocinfreisetzungsprotein ............... 25
2.5.3.6
Coexpression von Chaperonen bei der Überexpression................................. 25
2.5.4
Plasmidstabilitätstest der pET-Vektoren und Modifikationen des Testverfahrens26
I
Inhaltsverzeichnis
2.5.4.1
Plasmidstabilitätstest der pET-Vektoren ........................................................ 26
2.5.4.2
Schnellüberprüfung auf Expressionsfähigkeit der Transformanden .............. 26
2.5.4.3
Schnellüberprüfung der Toxizität von ModA und ModB sowie deren
Mutanten......................................................................................................... 27
2.5.5
2.6
Aufschluß von Bakterien und Reinigung von Einschlußkörpern.......................... 27
Arbeiten mit DNA........................................................................................................... 28
2.6.1
Methoden der Plasmidisolierung ........................................................................... 28
2.6.2
Enzymatische Modifikationen von Plasmid-DNA ................................................ 28
2.6.3
Polymerase Kettenreaktion (PCR)......................................................................... 28
2.6.4
Mutagenese............................................................................................................ 29
2.6.5
Agarose-Gelelektrophorese ................................................................................... 29
2.6.6
Isolierung von DNA-Fragmenten aus Agarosegelen............................................. 30
2.6.7
DNA-Sequenzierung nach SANGER et al. (1977) .................................................. 30
2.7
Arbeiten mit Proteinen .................................................................................................... 30
2.7.1
Bestimmung von Proteinkonzentrationen ............................................................. 30
2.7.2
SDS-Polyacrylamid-Gelelektrophorese................................................................. 31
2.7.2.1
Coomassie Brillantblau Färbung .................................................................... 32
2.7.2.2
Silberfärbung .................................................................................................. 32
2.7.3
Aufreinigung von „His-Tag“-Proteinen ................................................................ 32
2.7.3.1
2.7.4
Immobilisierte Metallchelat-Affinitätschromatographie................................ 33
Renaturierung von Proteinen ................................................................................. 34
2.7.4.1
Renaturierung durch Verdünnung .................................................................. 34
2.7.4.2
Renaturierung durch Dialyse.......................................................................... 35
2.7.5
Transfer von Proteinen auf Polyvinylidenfluorid (PVDF)-Membranen (Western
Blot) ....................................................................................................................... 36
2.7.6
2.8
Nachweis von rekombinanten „His-Tag“ Proteinen ............................................. 37
ADP-Ribosyltransferase Aktivitätstest ........................................................................... 37
2.8.1
Aktivitätstest mit 32P-NAD+ .................................................................................. 37
2.8.2
Bestimmung der ADP-Ribosyltransferase Aktivität mit p-Nitrobenzylidinaminoguanidin (NBAG) ........................................................................................ 38
2.8.2.1
2.9
Herstellung von p-Nitrobenzylidin-aminoguanidin (NBAG) ........................ 39
Transkriptionsversuche ................................................................................................... 39
2.9.1
Transkription von pKWIII Plasmiden ................................................................... 40
II
Inhaltsverzeichnis
2.9.2
3
Transkription von genomischer DNA ................................................................... 41
Ergebnisse...................................................................................................................... 42
3.1
Computergestützte Auswertung der Proteinsequenzen von ModA und ModB.............. 42
3.2
Klonierung der beiden offenen Leserahmen zwischen den T4 Promotoren p11.815 und
p13.149............................................................................................................................ 43
3.2.1
Klonierungsversuche in die Vektoren pBluescript II KS/SK................................ 43
3.2.2
Klonierungsversuche in die Vektoren pT7-5 und pT7-6....................................... 44
3.2.3
Klonierungsversuche in den Vektor pGEX-3X..................................................... 45
3.2.4
Klonierungsversuche in die pET-Vektoren ........................................................... 45
3.2.5
Klonierungsversuche in den Vektor pBAD/HisB ................................................. 50
3.3
Anzucht von Transformanden in Gegenwart von ADP-Ribosyltransferase Inhibitoren 51
3.4
Identifizierung des Mod-Proteins, das die E. coli RNA-Polymerase modifiziert........... 52
3.5
Überexpression von Mod ................................................................................................ 53
3.5.1
Überexpression aus pET-Vektoren........................................................................ 53
3.5.1.1
Überexpression mit λCE6 .............................................................................. 53
3.5.1.2
Überexpression mit mGP1-2 .......................................................................... 53
3.5.1.3
Überexpression aus DE3 Stämmen ................................................................ 53
3.5.2
Überexpression aus dem Vektor pBAD ................................................................ 56
3.6
Reinigung von ModA unter denaturierenden Bedingungen ........................................... 57
3.7
Nachweis des „His-Tags“ ............................................................................................... 58
3.8
Versuche zur Vermeidung von Einschlußkörpern .......................................................... 59
3.8.1
Veränderungen der Expressionsbedingungen ....................................................... 59
3.8.2
Überexpression in Gegenwart des Bakteriocinfreisetzungsproteins ..................... 60
3.8.3
Ausschleusen der exprimierten Proteine in den periplasmatischen Raum ............ 60
3.8.4
Coexpression von Chaperonen .............................................................................. 61
3.8.5
Fusion von ModA mit Thioredoxin....................................................................... 61
3.9
Renaturierung von Einschlußkörpern ............................................................................. 61
3.9.1
Renaturierung durch Verdünnung ......................................................................... 61
3.9.2
Renaturierung durch Dialyse ................................................................................. 62
3.10 Reinigung von ModA unter nativen Bedingungen ......................................................... 62
3.11 Nachweis katalytisch aktiver Aminosäuren durch ortsgerichtete Mutagenese............... 63
3.12 Entfernung des Trx aus p32modA2 ................................................................................ 66
3.13 ADP-Ribosylierung durch ModA und ModB................................................................. 68
III
Inhaltsverzeichnis
3.14 Bestimmung der ADP-Ribosyltransferase Aktivität von ModA .................................... 70
3.14.1
Herstellung von p-Nitrobenzylidin-aminoguanidin............................................... 70
3.14.2
Bestimmung von KM und Vmax .............................................................................. 71
3.15 Transkriptionsversuche mit alterierter und modifizierter E. coli RNA-Polymerase ...... 74
4
Diskussion ...................................................................................................................... 77
4.1
Klonierung von modA und modB.................................................................................... 77
4.2
Gründe für die Toxizität von ModA und ModB............................................................. 80
4.3
Expression von ModA und ModB .................................................................................. 81
4.3.1
Expression von ModA und ModB aus pET-Vektoren .......................................... 81
4.3.1.1
4.3.2
Expression aus p32modA-His ........................................................................ 84
Expression von ModA aus dem pBAD-Vektor..................................................... 85
4.4
Vermeidung von Einschlußkörpern ................................................................................ 86
4.5
Renaturierung von denaturierten Proteinen .................................................................... 89
4.6
Reinigung von ModA...................................................................................................... 91
4.7
Mutanten von ModA und ModB..................................................................................... 92
4.8
ADP-Ribosylierung durch ModA und ModB................................................................. 96
4.8.1
4.9
ADP-Ribosylierung der α-Untereinheit durch ModA........................................... 97
ADP-Ribosyltransferase Aktivität von ModA.............................................................. 100
4.10 Transkriptionsversuche mit alterierter und modifizierter E. coli RNA-Polymerase .... 103
5
Zusammenfassung....................................................................................................... 106
6
Literaturverzeichnis ................................................................................................... 108
IV
Abkürzungsverzeichnis
Abkürzungsverzeichnis
αCTD
A
A. dest.
Abb.
Amp
APS
ATP
bp
BRP
C
Cam
cAMP
CT
CTP
Da
dATP
ddH2O
DMSO
DNA
dNTP
DRAG
DRAT
dsDNA
DT
DTE
DTT
E. coli
EDTA
et al.
G
gp
GST
GuHCl
HRP
IMAC
IPTG
Kan
kb
kbp
kDa
kkat
KM
LT
MCS
min
α-Carboxyterminale Domäne der E. coli RNA-Polymerase
Adenin
destilliertes Wasser (Aqua destillata)
Abbildung
Ampicillin
Ammoniumpersulfat
Adenosin-5'-triphosphat
Basenpaar
Bakteriocinfreisetzungsprotein (bacteriocin release protein)
Cytosin
Chloramphenicol
zyklisches Adenosinmonophosphat (cyclic adenosin monophosphat)
Cholera Toxin von Vibrio cholerae
Cytidin-5'-triphosphat
Dalton
desoxy Adenosin-5'-triphosphat
doppelt destilliertes Wasser
Dimethylsulfoxid
Desoxyribonucleinsäure (desoxyribonucleic acid)
desoxy Nucleosid-5'-triphosphat
Dinitrogenase-Reduktase-ADP-Ribose-Glycohydrolase von
Rhodospirillum rubrum
Dinitrogenase-Reduktase-ADP-Ribosyltransferase von Rhodospirillum
rubrum
Doppelstrang-DNA (double strand DNA)
Diphtherie Toxin von Corynebacterium diphtherie
Dithioerythritol
Dithiothreitol
Escherichia coli
Ethylendiamintetraessigsäure (ethylen diamin tetra acetic acid
und andere (et alius)
Guanin
Genprodukt
Glutathion-S-Transferase
Guanidinium Hydrochlorid
Meerrettich-Peroxidase (horseradish peroxidase)
immobilisierte Metallchelat-Affinitätschromatographie
Isopropyl-β-D-thiogalaktosid
Kanamycin
Kilobasen
Kilobasenpaare
Kilo Dalton
katalytische Konstante
Michaelis-Konstante
Escherichia coli hitzelabiles Enterotoxin
multiple Klonierungsstelle (multiple cloning site)
Minute(n)
V
Abkürzungsverzeichnis
MOI
NAD+
NBAG
Ni-NTA
ODxxx
ORF
oxi.
PAETA
PCR
PDB
PEG
pfu
PMSF
POPOP
PPO
PT
PVDF
red.
RNA
RNAP
RSA
RT
SD
SDS
ssDNA
Str
SV
T
TCA
TEMED
Tet
Tris
Trx
TTP
U
UP
Upm
UTP
v/v
Vmax
w/v
xg
Vielfache der Infektion (multiplicity of infection)
Nicotinamid-adenin-dinucleotid (oxidiert)
p-Nitrobenzylidin-aminoguanidin
Nickel-Nitrilotriessigsäure (Nickel-nitrilotriacetic acid)
optische Dichte bei xxx nm Wellenlänge
offener Leserahmen (open reading frame)
oxidiert
Pseudomonas aeruginosa Exotoxin A
Polymerase Kettenreaktion (polymerase chain reaction)
3D Struktur Proteindatenbank (Brookhaven Protein Data Base)
Polyethylenglykol
plaquebildende Einheit (plaque forming unit)
Phenylmethylsulfonylfluorid
1,4-Bis(5 phenyl-2 oxazol) benzen
2,5-Diphenyloxazol
Pertussis Toxin von Bordetella pertussis
Polyvinylidenfluorid
reduziert
Ribonucleinsäure (ribonucleic acid)
RNA-Polymerase von E. coli
Rinderserumalbumin
Raumtemperatur
Shine-Dalgarno
Natriumdodecylsulfat (sodium dodecyl sulfate)
Einzelstrang-DNA (single strand DNA)
Streptomycin
Säulenvolumen
Thymin
Trichloressigsäure (trichlor acetic acid)
N,N,N',N'-Tetramethylethylendiamin
Tetracyclin
Tris-(hydroxymethyl)-aminomethan
Thioredoxin
Thymidin-5'-triphosphat
Enzymeinheit (Unit)
stromaufwärts (upstream)
Umdrehungen pro Minute
Uridin-5'-triphosphat
Volumen pro Volumen (volume per volume)
Maximalgeschwindigkeit
Gewicht pro Volumen (weight per volume)
Vielfache der Erdbeschleunigung (9,81 m/s2)
VI
Einleitung
1 Einleitung
Wilhelm Roux stellte 1915 einen Katalog der funktionellen Merkmale des Lebens auf.
Zum Leben gehören nach seiner Definition ein Stoffwechsel, bestehend aus Aufnahme,
Assimilation, Dissimilation und Ausscheidung, Wachstum, Bewegung, bestehend aus
Erregbarkeit und spontaner Bewegungsfähigkeit, Vermehrung und Vererbung. Nach dieser
Definition können Bakteriophagen, das sind Viren, die Bakterien befallen, nicht als lebend
angesehen werden, da den Viren ein eigener Stoffwechsel fehlt und sie weder wachsen
noch erregbar sind. Für ihre eigene Vermehrung müssen die Viren deshalb den
Stoffwechsel des Wirtes unter ihre Kontrolle bekommen. Sie rekrutieren dabei
hauptsächlich die Ribosomen, die essentiell für die Proteinbiosynthese sind, und zum Teil
die RNA-Polymerase des Wirtes. Die Viren bestehen aus einer mehr oder weniger
komplexen Proteinhülle, in die das virale Erbmaterial verpackt ist. Das Erbmaterial besteht
entweder aus dsDNA (λ, T-Phagen), ssDNA (M13) oder RNA (HIV, f2). Die Phagenhülle
kann filamentös (M13), kugelig (Qβ, ΦX174) oder komplizierter aus einem Kopf- und
Schwanzteil (λ, T-Phagen) bestehen.
1.1 Der Bakteriophage T4
Der Bakteriophage T4 gehört zu den geradzahligen T-Phagen (T2, T4, T6) und sein Wirt
ist Escherichia coli. Elektronenmikroskopische Aufnahmen zeigten, daß der T4 aus einem
ikosaedrischen Kopf besteht, an dem ein etwa gleich langer Schwanz sitzt, der aus einer
kontraktilen Scheide mit einer zentralen Röhre besteht (Abb. 1.1). Zwischen Kopf und
Schwanz befindet sich der Kragen mit sechs „Whisker“. An der Basalplatte der Scheide
sitzen
sechs
Schwanzfasern
zur
Anheftung
an
spezifische
Rezeptoren
der
Bakterienzellwand. Das Genom besteht aus einer dsDNA mit 168.895 bp. Die DNA weist
eine terminale Redundanz von ca. 3 kbp auf und ist wegen der Verpackung nach dem
Kopf-Voll-Mechanismus zirkulär permutiert (STREISINGER et al., 1964; 1967). Eine
Eigenart der T4 DNA ist das Vorhandensein von glycosyliertem 5-Hydroxymethyl-Cytosin
statt des herkömmlichen Cytosins (Abb. 1.2), wodurch die Phagen DNA gegen den Verdau
durch bakterielle Nukleasen geschützt ist (WYATT & COHEN, 1952; TAKAHASHI et al.,
1979). Auf dem T4 Genom sind bisher ca. 150 Gene bekannt und es befinden sich dort
noch einmal ca. 150 offene Leserahmen dessen Funktionen noch nicht ermittelt werden
konnten (KUTTER et al., 1994). Diese Vielzahl der Gene erfordert eine zeitlich koordinierte
Expression für eine effiziente Phagenvermehrung.
1
Einleitung
Abb. 1.1
Schematische Darstellung des Bakteriophagen T4.
H
NH2
NH2
N
O
N
R
Cytosin
Abb. 1.2
CH2 O
N
O
O
CH2OH
H
H
H
HO OH
OH H
N
R
alpha-Glucosid des 5-Hydroxymethyl-Cytosin
Strukturvergleich zwischen Cytosin und glycosyliertem 5-Hydroxymethyl-Cytosin.
Die Entwicklung des Bakteriophagen T4 verläuft nach einem vorherbestimmten
Programm, wobei verschiedene Gruppen von Genen zu bestimmten Zeitpunkten nach der
Phageninfektion exprimiert werden. Die zeitliche Kontrolle der T4 Genexpression wird auf
der Ebene der Transkription durch drei unterschiedliche Promotortypen (frühe, mittlere
und späte) erreicht (Abb. 1.3). Für die RNA-Synthese wird während der gesamten T4
Infektion die wirtseigene DNA abhängige RNA Polymerase (EC 2.7.7.6) verwendet. Das
Core-Enzym der E. coli RNA-Polymerase bleibt während der gesamten T4 Infektion aktiv
und transkribiert die gesamte Phagen DNA (DIMAURO et al., 1969; HASELKORN et al.,
1969). Bis zu 13 phagenkodierte Proteine modifizieren die RNA-Polymerase oder
assoziieren mit ihr, was zu einer schrittweisen Erkennung der drei unterschiedlichen
Promotortypen und zu Antiterminationen führt (MOSIG & HALL, 1994; WILKENS & RÜGER,
1994; STITT & HINTON, 1994; WILLIAMS et al., 1994).
2
Einleitung
Promotorklasse
(1) E. coli
(2) T4 „früh“
(3) T4 „mittel“
(4) T4 „spät“
Abb. 1.3
„-35“-Region
Abstand
„-10“-Region
TTGACA
(16 - 18 bp)
TATAAT
GTTTACt/attcc
(11 bp)
GTGGTAt/ca/tATa
Mot-Box (-30 Region)
a a
/t /tTGCTTt/cA
(12 – 17 bp)
TATAAT
------
------
TATAAATActatt
Konsensussequenzen für die verschiedenen Promotoren von T4 und E. coli.
(1) (HAWLEY & MCCLURE, 1983; HARLEY & REYNOLDS, 1987)
(2) (LIEBIG & RÜGER, 1989)
(3) (GUILD et al., 1988)
(4) (KASSAVETIS et al., 1986)
1.1.1 Die Genexpression des Bakteriophagen T4
Die 37 bekannten frühen Promotoren des T4 werden von der E. coli RNA-Polymerase mit
dem σ70-Faktor erkannt. Diese Promotoren ähneln den E. coli Promotoren und weisen eine
erweiterte –10 Sequenz auf. Außerdem besitzen sie in den Bereichen „-42“ und „-52“
charakteristische A/T reiche UP-Elemente (WILKENS & RÜGER, 1994). Die unveränderte
RNA-Polymerase transkribiert in vitro nur von den frühen T4 Promotoren, die mittleren
und späten Promotoren werden von ihr nicht erkannt. Die erste Modifikation der RNAPolymerase erfolgt durch das gpAlt (Alteration). Alt liegt mit ca. 25 – 50 Kopien im
Phagenkopf vor und wird bei der Infektion mit der Phagen-DNA in die Zelle injiziert
(GOFF, 1979). In den ersten 30 Sekunden wird eine der beiden α-Untereinheiten ADPribosyliert. Die zweite Untereinheit kann, wahrscheinlich auf Grund sterischer
Behinderung, nicht ribosyliert werden (ZILLIG et al., 1977). Durch diese „Alteration“
werden einige frühe Promotoren verstärkt abgelesen (KOCH et al., 1995). Vom Promotor
P13.149, der durch die „Alterierung“ am stärksten verstärkt wird, wird die zweite, bis vor
Beginn dieser Arbeit bekannte, ADP-Ribosyltransferase Mod (Modifikation) transkribiert.
Mod ADP-ribosyliert die zweite α-Untereinheit und beendet damit möglicherweise die
Transkription von den frühen Promotoren (WILKENS et al., 1997). Diese Modifikation
durch Mod ist vier Minuten nach der Infektion abgeschlossen (GOFF, 1974; HORVITZ,
1974b).
Durch die Bildung der frühen Genprodukte AsiA (Anti Sigma) und MotA (modifier of
transcription) wird von der frühen Transkription auf die mittlere Transkription
3
Einleitung
umgeschaltet. Die mittleren Promotoren haben eine –10 Region, die von σ70 erkannt wird,
aber keine –35 Region (STITT & HINTON, 1994). Die feste Bindung von AsiA an die σ70Untereinheit der RNA-Polymerase ist wichtig für den Übergang zwischen der frühen und
mittleren T4 Transkription. AsiA verhindert sowohl die Erkennung der Wirts- als auch der
frühen T4 Promotoren und stimuliert die Transkription von den mittleren Promotoren
(OUHAMMOUCH et al., 1994; 1995). Außerdem wird noch MotA benötigt, das die „MotBox“ um Position –30 der mittleren Promotoren erkennt (OUHAMMOUCH et al., 1995;
MARCH-AMEGADZIE & HINTON, 1995). Die mittlere Transkription nutzt zum Teil immer
noch frühe Promotoren (HINTON, 1989; HSU & KARAM, 1990), jedoch werden die
Transkripte durch Antiterminationsfaktoren bis über 15 kb verlängert (SANSON & UZAN,
1993; BRODY & GEIDUSCHEK, 1970).
Die späte Transkription ist an die Replikation des T4 Genoms gekoppelt, da sie durch
Einzelstrangbrüche positiv beeinflußt wird (HERENDEEN et al., 1989). Die späten T4
Promotoren weisen nur eine –10 Region auf, die von dem T4 gp55 (σ-Faktor) erkannt
wird, aber noch Transkriptionsaktivatoren benötigt (BRODY et al., 1995; LEONETTI et al.,
1998). Dazu gehören gp45 die sogenannte „sliding clamp“, der gp44-gp62-Komplex (DNA
Ladefaktor) und gp33 (Co-Aktivator) (NOSSAL, 1994; YOUNG et al., 1994; TINKER et al.,
1994; HERENDEEN et al., 1990).
Nach etwa 25 Minuten sind ca. 150 neue Phagenpartikel zusammengebaut. Durch Lyse der
Wirtszelle werden diese dann für die Infektion neuer Wirte freigesetzt.
1.2 ADP-Ribosyltransferasen
ADP-Ribosylierung ist eine posttranslationale Modifikation bei der ein ADP-Riboserest
vom NAD+ auf unterschiedlichste Proteine übertragen wird (Abb. 1.4). Diese Reaktion
wird
durch
virale,
bakterielle
oder
eukaryontische
Mono-
oder
Poly-ADP-
Ribosyltransferasen (EC 2.4.2.30) katalysiert (DOMENIGHINI & RAPPUOLI, 1996). PolyADP-Ribosyltransferasen sind bisher allerdings nur bei Eukaryonten in den Zellkernen
gefunden worden (SHALL, 1995)
Eine Poly-ADP-Ribosyltransferase ist im Nukleus von vielen Eukaryonten zu finden und
verrichtet dort wichtige Aufgaben. So hält sie die Genomintegrität während der
Excisionsreparatur von Basen aufrecht (DEMURCIA et al., 1997), hilft bei der DNA
Rekombination (SATOH et al., 1994) und der Zelldifferenzierung (FARZANEH et al., 1987).
Außerdem ist sie an der Organisation des Chromatins beteiligt (REALINI & ALTHAUS,
4
Einleitung
1992). Es werden Histone und Proteine, die an der Replikation beteiligt sind, modifiziert.
Diese Proteine verlieren dadurch ihre Affinität zur DNA und es wird Platz für die DNA
Reparatur geschaffen. Außerdem scheint die Poly-ADP-Ribosyltransferase auch eine Rolle
während der Apoptose zu spielen (BERNARDI et al., 1995).
O
N
O
OH
N
N
+
O
Rest
CH2
O P O
+
OH
O
Abb. 1.4
Argininseitenkette
N
N
CH2
+
NH2
N
+
+
H
O
OH
+
O
N
N
O
OH
+
NH2
NH
O P O
NAD
NH
OH
NH2
NH2
O
OH
O
HN
Transferase
H2N
Rest
O
N
H
N
N
CH2
Rest
OH
NH2
O P O
O
N
H
+
CH2
O
O
Rest
NH2
O
O P O
OH
ribosylierte Seitenkette
Nicotinamid
Schema der NAD+: Arginin ADP-Ribosyltransferase katalysierten Reaktion. Ob es
sich bei dieser Reaktion um einen SN1 oder SN2 Mechanismus handelt konnte noch
nicht geklärt werden (BELL & EISENBERG, 1996).
Mono-ADP-Ribosyltransferasen wurden ursprünglich als pathogenes Prinzip des
Diphtherie Toxins (DT), Cholera Toxins (CT), Pertussis Toxins (PT), Pseudomonas
aeruginosa Exotoxins A (PAETA) und anderer bakterieller Toxine entdeckt (HONJO et al.,
1968; MOSS & VAUGHAN, 1976; KATADA & UI, 1982; IGLEWSKI & KABAT, 1975). Sie
wurden außerdem z.B. in Erythrocyten von Truthähnen, in der Milz von Hühnern und in
Skelett- und Herzmuskeln von Säugetieren gefunden (OKAZAKI & MOSS, 1996). MonoADP-Ribosyltransferasen von Eukaryonten scheinen u.a. an der Immunregulation beteiligt
zu sein (WANG et al., 1994).
Einige Gene der bakteriellen Toxine stammen jedoch aus Phagen. So stammt das
Strukturgen für das Cholera-Toxin aus einem filamentösen Phagen, der sich in das
Chromosom von Vibrio cholerae integriert hat (WALDOR & MEKALANOS, 1996). Ebenso
stammt das Gen für Diphtherie Toxin in Corynebacterium diphtherie vom lysogenen
Phagen β (UCHIDA et al., 1971).
Durch die ADP-Ribosylierung werden die Akzeptorproteine häufig inaktiviert. So
inhibieren DT und PAETA durch die ADP-Ribosylierung des eukaryontischen
Elongationsfaktors 2 (EF2) die Proteinsynthese, was zum Zelltod führt (PASSADOR &
5
Einleitung
IGLEWSKI, 1994). In manchen Fällen wird die Aktivität jedoch durch korrespondierende
ADP-Ribosyl-Hydrolasen wieder hergestellt. So z.B. bei dem photosynthetisch aktiven
Bakterium Rhodospirillum rubrum. Hier wird die Stickstoffixierung durch eine
Dinitrogenase-Reduktase-ADP-Ribosyltransferase (DRAT) und eine entgegen wirkende
Dinitrogenase-Reduktase-ADP-Ribose-Glycohydrolase (DRAG) reguliert (POPE et al.,
1985; LOWERY et al., 1986; Ludden, 1994).
Die verschiedenen bakteriellen ADP-Ribosyltransferasen zeigen keine Homologien in der
Aminosäuresequenz. Sie weisen aber drei ähnliche Regionen auf (DOMENIGHINI et al.,
1994). Region I enthält ein nukleophiles Arginin oder Histidin, was für die Bindung des
NAD+ essentiell ist. Der Austausch des His440 von PAETA oder des His21 von DT in der
Region I führt zu einem drastischen Aktivitätsverlust (HAN & GALLOWAY, 1995). Der
konservative Austausch des Arg7 im hitzelabilen Enterotoxin von E. coli (LT) und im CT,
bzw. des Arg9 im PT gegen Lysin führte zum vollständigen Verlust der Enzymaktivität
(LOBET et al., 1991; BURNETTE et al., 1988; 1991). Die Region II weist viele aromatische
und hydrophobe Aminosäuren auf, die an der hydrophoben Interaktion mit den
aromatischen Ringen des NAD+ beteiligt sein sollen. In der Region III befindet sich ein
vollständig konserviertes Glutamat, was für die katalytische Aktivität eine wichtige Rolle
spielt (DOMENIGHINI et al., 1994). So inhibierte z.B. der Austausch des Glu148 von DT oder
des Glu553 von PAETA die Enzymaktivität ohne den KM-Wert für NAD+ zu beeinflussen
(TWETEN et al., 1985; DOUGLAS & COLLIER, 1987).
Die Kristallisation von DT mit NAD+ lieferte Hinweise, daß in den bakteriellen ADPRibosyltransferasen DT, PAETA, LT und PT ähnliche NAD+-Bindetaschen vorhanden
sind, auch wenn weniger als 10 % Aminosäurehomologien bestehen (Abb. 1.5). Diese
Bindetasche unterscheidet sich völlig von der Rossmannfaltung einiger Dehydrogenasen,
die NAD+ als Coenzym verwenden (BELL & EISENBERG, 1996; ROSSMANN et al., 1975).
DOMENIGHINI und RAPPUOLI (1996) haben das Modell der NAD+-Bindetasche auf alle
bisher
bekannten
Mono-
und
Poly-ADP-Ribosyltransferasen
von
Eukaryonten,
Prokaryonten und Viren ausgeweitet.
6
Einleitung
Abb. 1.5
Überlagerung der dreidimensionalen Strukturen des β/α Motivs, das die NAD+Bindetasche von LT (grün), DT (rot), PAETA (blau) und PT (gelb) bildet. Das
gebundene NAD+ (himmelblau) ist so in die Grube eingeführt, wie es in der DT
Struktur vorliegt. Die konservierten Aminosäuren, die für die Katalyse wichtig
sind, sind in gelb angegeben. (aus DOMENIGHINI & RAPPUOLI, 1996)
Ob es sich bei dem ADP-Ribosylierungsmechanismus um eine SN1 oder SN2 Reaktion
handelt kann nicht genau bestimmt werden, da aufgrund der Kristalldaten beide
Reaktionstypen möglich sind (BELL & EISENBERG, 1996). Die bemerkenswerte
Konservierung der NAD+-Bindetasche und der Aminosäurereste, die an der Katalyse
beteiligt sind deuten aber auf einen ähnlichen Mechanismus für alle ADPRibosyltransferasen hin (DOMENIGHINI & RAPPUOLI, 1996).
1.2.1 Die ADP-Ribosyltransferasen des Bakteriophagen T4
Bislang waren zwei ADP-Ribosyltransferasen beim Bakteriophagen T4 bekannt, das gpAlt
und das gpMod. Durch die ADP-Ribosylierung von Wirtsproteinen und evtl. auch T4
eigener Proteine kann der Vermehrungszyklus des Phagen womöglich effizienter
ausgeführt werden.
Eine der ersten ADP-Ribosylierungen findet an einer der beiden α-Untereinheiten der
wirtseigenen DNA abhängigen RNA-Polymerase statt. Diese „Alteration“ wird durch das
T4 Protein Alt katalysiert und ist bereits 30 Sekunden nach der Infektion abgeschlossen.
Die zweite Untereinheit kann, wahrscheinlich auf Grund sterischer Behinderung, durch das
relativ große gpAlt nicht ribosyliert werden (ZILLIG et al., 1977). Die ADP-Ribosylierung
der RNA-Polymerase durch Alt bewirkt, daß einige frühe T4 Promotoren verstärkt
7
Einleitung
transkribiert werden (KOCH et al., 1995). Der ADP-Ribosylrest wird hauptsächlich auf das
Arg265 der α-Carboxyterminalen Domäne (αCTD) übertragen (GOFF, 1974; OVCHINNIKOV
et al., 1977) (Abb. 1.6). Ein geringer Anteil der Markierung findet sich aber auch am
Arg191 oder Arg195 in der Aminoterminalen Domäne (GOFF, 1984). Unter in vitro
Bedingungen werden noch viele andere Proteine wie z.B. Hühnereiweiß-Lysozym,
Rinderserumalbumin, Histon F1 und ebenfalls in vivo die anderen RNA-Polymerase
Untereinheiten durch Alt ADP-ribosyliert (ROHRER et al., 1975; HORVITZ, 1974b). Unter
in vitro Bedingungen wurden aber auch noch viele andere E. coli Proteine durch ADPribosyliert. Dies alles ist ein Hinweis darauf, daß die ADP-Ribosylierung durch Alt nicht
sehr spezifisch ist.
Das alt Gen befindet sich zwischen den Genen 30 (DNA Ligase) und 54
(Basisplattenprotein) auf der genomischen Karte von T4 (GOFF, 1979) (Abb. 1.7). Das Alt
Protein wird erst spät während der T4 Infektion als ein 79 kDa Vorläuferprotein gebildet
(HORVITZ, 1974b). Diese Vorstufe wird jedoch während des Zusammenbaus der
Phagenpartikel proteolytisch zum aktiven 67 kDa Alt Protein gespalten und 25 bis 50
Moleküle dieses Enzyms in den Phagenkopf verpackt. Bei der Infektion mit der Phagen
DNA wird das gpAlt mit in die Wirtszelle injiziert (HORVITZ, 1974a; ROHRER et al., 1975;
GOFF, 1979).
Abb. 1.6
Die 3D Struktur der αCTD der RNA-Polymerase dargestellt als „Cartoon“ (links)
und „Strand“ (rechts) (mit RasMol generiert, PDB Kode: 1COO (JEON et al.,
1995)). Es ist der Aufbau aus den vier α-Helices (H1 – H4) wiedergegeben und
das Arg265 ist hervorgehoben (links). In der rechten Abbildung sind die anderen
Arginine als mögliche Ribosylierungsstellen dargestellt.
8
Einleitung
Abb. 1.7
Genomische Karte des Bakteriophagen T4 (KUTTER et al., 1994).
Die ADP-Ribosylierung der zweiten α-Untereinheit erfolgt durch das gpMod
(Modifikation). Die Lage des mod Gens wurde durch Deletionskartierung auf den Bereich
zwischen den Genen 39 (DNA Topoisomerase Untereinheit) und 56 (dCTPase) auf der
genomischen Karte eingeschränkt (HORVITZ, 1974a) (Abb. 1.7). Die ADP-Ribosylierung
beider α-Untereinheiten am Arg265 ist nach vier Minuten durch dieses neusynthetisierte 23
kDa große Protein vollendet (GOFF, 1974; HORVITZ, 1974b). Nach diesen vier Minuten
fällt die Aktivität von Mod stark ab (SKORKO et al., 1977). Im Gegensatz zu Alt kann Mod
beide α-Untereinheiten modifizieren. Es modifiziert aber nicht die anderen Untereinheiten
der RNA-Polymerase. Diese ADP-Ribosylierung bleibt für den Rest der T4 Infektion
erhalten und wird nicht wieder rückgängig gemacht (HORVITZ, 1974a; GOFF & SETZER,
1980). Im Gegensatz zu Alt wirkt Mod spezifischer. Es wurde nur noch ein 13 kDa Protein
gefunden, das von Mod ribosyliert wird, ob es ein E. coli Protein oder ein T4 Protein ist
wurde jedoch nicht ermittelt (SKORKO et al., 1977). Die Modifikation der RNAPolymerase durch Mod verändert das Enzym dahingehend, daß E. coli Gene nicht mehr
transkribiert werden, die Transkription der T4 Gene aber unbeeinflußt bleibt.
9
Einleitung
Die Unterschiede zwischen Alteration und Modifikation sind folgende. (1) Die Alteration
benötigt keine Proteinsynthese, da Alt bei der Infektion mit der T4 DNA in die Zelle
gelangt. Für die Modifikation wird die Expression von Mod benötigt. (2) Die Modifikation
ist spezifischer als die Alteration, d.h. es werden nicht so viele Proteine durch Mod
markiert. (3) Mod ADP-ribosyliert beide α-Untereinheiten der RNA-Polymerase,
wohingegen Alt nur eine α-Untereinheit in der RNA-Polymerase markiert. (4) Mod hängt
an der α-Untereinheit nur an einer Aminosäureseitenkette einen ADP-Ribosylrest,
während Alt an verschiedenen Argininresten der α-Untereinheit einen solchen Rest setzt
(HORVITZ, 1974b).
Die biologischen Auswirkungen der ADP-Ribosylierung der RNA-Polymerase für den
Phagen sind nicht bekannt, da eine T4 alt-, mod- Doppelmutante keine signifikanten
Auswirkungen während des Infektionszyklus zeigt (GOFF & SETZER, 1980). Es wurde
vermutet, daß die ADP-Ribosylierung der Wirts RNA-Polymerase an der Blockierung der
bakteriellen RNA-Synthese beteiligt sein könnte (MAILHAMMER et al., 1975; GOLDFARB &
PALM, 1981). Die Blockierung der bakteriellen RNA-Synthese findet in alt-, modMutanten aber immer noch statt (GOFF & SETZER, 1980) und die konstitutive Expression
von Alt führt zu keiner Wachstumshemmung bei E. coli (KOCH et al., 1995).
Alt und Mod könnten evtl. unter nicht Laborbedingungen zu einem breiteren
Wirtsspektrum führen oder einen leichten Wuchsvorteil des T4 bewirken, der mit den
eingesetzten Methoden nicht erkannt werden kann (HORVITZ, 1974a; GOFF & SETZER,
1980).
An Hand von T4 Deletionsmutanten, die keine Mod-Aktivität mehr aufweisen, war vor
Beginn dieser Arbeit bereits vermutet worden, daß das Gen für die ADPRibosyltransferase Mod zwischen den T4 Promotoren P11.815 und P13.149 liegen müßte.
Sequenzdaten aus diesem Bereich zeigten, daß hier zwei offene Leserahmen hinter dem
frühen Promotor P13.149 liegen, die durch ein ATGA verbunden sind, wobei das ATG das
Start-Codon des zweiten Gens und das TGA das Stop-Codon des ersten Gens darstellt
(Abb. 1.8). Es war bisher allerdings noch nicht gelungen einen dieser beiden Leserahmen
komplett zu klonieren. Eine Sequenzhomologiesuche in den Datenbanken gab keinen
Hinweis darauf, welcher dieser beiden Leserahmen für eine ADP-Ribosyltransferase
kodieren
könnte.
Erst
„Threading-Experimente“,
d.h.
ein
Alignment
der
Sekundärstrukturen mit bekannten ADP-Ribosyltransferasen zeigte, daß beide Proteine
10
Einleitung
sehr wahrscheinlich zu den NAD(P)+-Arginin ADP-Ribosyltransferasen (EC 2.4.2.31)
gehören (Abb. 1.9) (BAZAN & KOCH-NOLTE, 1997; WILKENS et al., 1997). Es war bis
dahin nicht bekannt, welches der beiden Proteine die E. coli RNA-Polymerase ADPribosyliert oder ob beide Proteine diese Reaktion unabhängig katalysieren können, bzw. ob
Mod sogar als Heterodimer vorliegt.
AccI
DraI
200
P13.149
Abb. 1.8
SpeI
DraI
HindIII
DraI
DdeI
DdeI
RsaI
DraI
RsaI
NsiI
400
ORF1
600
ATGA
800
(1467 bps)
PvuII
PvuII
DdeI
DdeI
NdeI
DraI
EcoRI
HincII
1000
1200
ORF2
1400
P11.815
Anordnung der beiden offenen Leserahmen zwischen den frühen Promotoren P11.815
und P13.149. Des weiteren sind einige Schnittstellen für Restriktionsendonukleasen
angegeben, die aus den Sequenzdaten ermittelt wurden.
Toxa_Pseae
Dtx_Corbe
Elap_Ecoli
Chta_Vibch
Tox1_Borpe
Parp_Chick
Alt_Bpt4
Alt_bpt6
ModA_Bpt4
ModB_Bpt4
GYVFVGYHGTFLEAAQSIVFGGVRARSQD........................LDAIWRGFYIAGDPALAYGYAQDQEPDA...
..NFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYD.....................DDWKGFYSTDNKYDAAGYSVDNENPL...
..GDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSG....
..DDKLYRADSRPPDEIKQSGGLMPRGQSEYFDRGTQMNINLYDHARGTQTGFVRHDDGYVSTSISLRSAHLVGQTILSG....
DPPATVYRYDSRPPEDVFQNGFTAWGNND...........NVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEA
HNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVT....................GYMFGKGIYFADMVSKSANYCHTSQA.....
PKGITLYRSQRMLPSIYEAMVKNRVF.............................YFRNFVSTSLYP.NIFGTWMTDSSIGVLP
PEGITVYRAQSMTAPIYEALVKNKVF.............................YFRNFVSTSLTP.IIFGRFGITHAGIGLL
PNDKPLWRGVPAETKQVLNQGIDIITFDKVVSASY.................DKNIALHFASGLEYNTQVIFEFKAP.......
KSPYQLYRGISKSTKELIKDLQVGEVFSTNRVDSF................TTSLHTACSFSYAEYFTETILRLKTD.......
β1
Toxa_Pseae
Dtx_Corbe
Elap_Ecoli
Chta_Viboh
Tox1_Borpe
Parp_Chick
Alt_Bpt4
Alt_Bpt6
ModA_Bpt4
ModB_Bpt4
Ü b erh a ng S c hle ife
α1
β2
α2
........RGRIRN.GALLRVYVPRSLDAITQ..............PEEE......GGRLETILGWPLAERTVV.IPSA......
..........SGKA.GGVVKVTYPGSRVVLSL..............PFAEG.....SSSVEYINNWEQAKALSV.ELEINFE...
............YSTYYIYVIATA..PNMFNVNDVLGVYS......PHP........YEQEVSALGGI.PYSQIYGWYRVN....
............HSTYYIYVIATA..PNMFNVNDVLGAYS......PHP........DEQEVSALGGI.PYSQIYGWYRVH....
ERAGRGTG....HFIGYIYEVRAD..NNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRI.PPENIRRVTRVYHNGI
............DPIGLILLGEVALGNHSVKGLGKTAPDPTAPLGNGISTGINDTCLLYNEYIVYDV..AQVNLKYLLKLKFNYK
.DEKRLSVSIDKTDEGIGWVITGADKVNVVLPGGSLAPS..................NEMEVILPRGL.MVKVNKITDASYNDGT
EPEARNELTVDKNEEGIGWAIDGAHKVNVVYPG.SLGIA..................TEAEVILPRGL.MVKVNKITDASNNDGT
..............MVFNFQEYAIKALRCKEYNPNFKFP......DSHRYRNMELVSDEQEVMIPAGSVFRIADRYEYKKCSTYT
..............KAFNYSDHISDIILSSPNTEFKYTYEDTDGLDSERTDNLMMIVREQEWMIPIGKYKITSISKEKLHDSFGT
β3
β4
β5
β6
Abb. 1.9 Alignment von ausgesuchten ADP-Ribosyltransferasen eukaryotischer und prokaryotischer
Organismen sowie von T-Phagen (nach BAZAN & KOCH-NOLTE, 1997).
Toxa_Pseae: Exotoxin A von Pseudomonas aeruginosa; Dtx_Corbe: Diphtherie Toxin von
Corynebacterium diphtherie; Elap_Ecoli: hitzelabile Enterotoxin A von Escherichia coli;
Chta_Vibch: Cholera Toxin von Vibrio cholerae; Tox1_Borpe: Pertussis Toxin von
Bordetella pertussis; Parp_Chick: Poly-ADP-Ribosyltransferase von Gallus gallus;
Alt_Bpt4: Alt Protein von Phagen T4; Alt_Bpt6: Alt Protein von Phagen T6; ModA_Bpt4:
ModA Protein von Phagen T4; ModB_Bpt4: ModB Protein von Phagen T4.
11
Aufgabenstellung
1.3 Aufgabenstellung
Das erste Ziel dieser Arbeit war es die beiden offenen Leserahmen zu klonieren und das
Gen für mod, der zweiten ADP-Ribosyltransferase des Bakteriophagen T4, zu
identifizieren. Nach der Klonierung sollte das gpMod überexprimiert und gereinigt werden.
Das gereinigte Protein sollte dann in einigen Aspekten wie Aktivität und Auswirkungen
auf die Transkription näher charakterisiert werden. Mit Hilfe ortspezifischer Mutagenese
sollten einige für die Katalyse als relevant postulierte Aminosäuren verifiziert bzw.
falsifiziert werden.
Außerdem sollte ein Reinigungsprotokoll für Mod erstellt werden, um es in ausreichender
Menge und Reinheit isolieren zu können. Dieses gereinigte Protein kann dann für
kristallographische
Untersuchungen
eingesetzt
werden.
Ein
Vergleich
mit
den
Tertiärstrukturen anderer ADP-Ribosyltransferasen könnte das Wissen über die
Funktionsweise dieser Proteine erweitern.
12
Material und Methoden
2 Material und Methoden
2.1 Geräteliste
Elektrophoresezubehör:
Agarose-Gelkammern:
Glasplatten, Kämme, Kammern
Protein-Gelkammern:
Mini-PROTEANII
Elektroporator:
Gene Pulse II
Geltrockner:
Biometra
Gel AirDryer
Inkubationsroller und –schüttler:
New Brunswick Scientific G10
Gio Gyrotory Shaker
PCR-Cycler:
Mini-Cycler™
Photometer:
PU 8730 UV/VIS
UV-Visible Spectrophotometer
Spannungsgeber:
EPS 3500
Power Pac 300
Vakuumzentrifuge:
Speed Vac Concentrator
Videodokumentation:
Gel Print 2000i
Western-Blot Apparatur:
Mini-Trans-Blot-Kammer
Zellaufschluß:
Branson Sonifier 250
Branson Sonifier B-12
French Pressure Cell Press
Zentrifugen:
Biofuge pico
Biofuge 15 R
Sorvall RC-5B
Werkstätten der Ruhr-Universität Bochum
BioRad, Richmond (USA)
BioRad, Richmond (USA)
Biometra, Göttingen
BioRad, Richmond (USA)
New Brunswick (Can)
New Brunswick (Can)
Biozym, Hessisch Oldendorf
Philips, Eindhoven (NL)
Pharmacia LKB, Freiburg
Pharmacia LKB, Freiburg
BioRad, Richmond (USA)
Uni Equip, München
MWG-Biotech, Ebersberg
BioRad, Richmond (USA)
Branson, Danbury (USA)
SLM-Aminco, Rochester (USA)
Heraeus, Osterode
Heraeus, Osterode
Du Pont, Bad Homburg
Alle weiteren Geräte entsprachen dem üblichen Laborstandard.
13
Material und Methoden
2.2 Elektronische Datenverarbeitung
Zur Auswertung und Darstellung der Ergebnisse wurden folgende Computerprogramme
verwendet:
Microsoft® Office 97 Professional (Microsoft Corporation)
CorelDraw™ 6 oder 8 (Corel Corporation)
DNAStar (DNAStar Inc.)
Tina 2.09g (Raytest GmbH)
Diverse PDB-Betrachter wie RasMol , WebLab Viewer, Swiss PDB Viewer, MolMol
Die in dieser Arbeit wiedergegebenen Bilder wurden elektronisch in das Dokument
eingebunden. Die Originalgele wurden mit Hilfe einer Videodokumentationsanlage
digitalisiert. Im Verlauf der Datenerfassung und Datenverarbeitung kam es zu keiner
inhaltlichen Veränderung der Abbildungen.
2.3 Chemikalien und Verbrauchsmaterialien
Acrylamid-Bisacrylamidstammlösungen:
Long Ranger Gellösung 19:1 50%
FMC, Vallenbaek Strand (DK)
(Sequenzgele)
Rotiphorese 29:1 40% (Proteingele)
Roth, Karlsruhe
DNA-modifizierende Enzyme, Restriktionsenzyme, MBI Fermentas, St. Leon-Rot; Gibco BRL,
Nukleotide, Polymerasen, RNase-Inhibitor
Neu-Isenburg; Boehringer, Mannheim
Molekularbiologische Kits:
Quiaquick Gel Extraction Kit
Qiagen, Hilden
NucleoSpin C+T
Macherey-Nagel, Düren
™
T7 Sequenzing Mixes
Pharmacia, Freiburg
Quickchange Mutagenese Kit
Stratagene, La Jolla (USA)
™
Wizard Minipreps Plus
Promega, Madison (USA)
Molekulargewichtsmarker:
MBI Fermentas, St. Leon-Rot
λ-Marker, EcoRI und HindIII geschnitten
MBI Fermentas, St. Leon-Rot
100 bp Leiter Plus
Gibco BRL, Neu-Isenburg
10 kDa Leiter
Oligonukleotide
Gibco BRL, Neu-Isenburg
PVDF-Membran:
Millipore, Eschborn
Immobilon-P
Radiochemikalien:
Hartmann Analytic GmbH, Braunschweig
α[32P]-UTP spez. Aktivität: 30 TBq/mmol
35
α[ S]-dATP spez. Aktivität: 600 Ci/mmol Hartmann Analytic GmbH, Braunschweig
NEN, Boston (USA)
[32P]NAD+ spez. Aktivität: 800 Ci/mmol
Röntgenfilm:
Fuji Medical X-Ray Film
Fuji (Japan)
Alle anderen nicht aufgeführten Chemikalien wurden in Analyse-Qualität von den Firmen
Biomol, Hamburg; J.T. Baker, Groß-Gerau; Merck, Darmstadt; Riedel-de Haën, Hannover;
Serva, Heidelberg und Sigma, München bezogen.
14
Material und Methoden
2.4 Biologisches Material
2.4.1 Plasmide
Plasmid/Vektor
pBluescript II KS
pBluescript II SK
pT7-5
pT7-6
pGEX-3X
pET-11d
pET-16b (+)
pET-22b (+)
pET-32b (+)
pLysS
pSW1
pBAD/His B
pGroESL
pBN19
p13.149
p8.182
ptac
pTKRI
p11modAB3
p11modBB5
p11modB1
p22modBB2
p16modA7
p16modB1
p16modA7-E165D
p16modA7-R72K
p16modB1-E173D
p16modB1-R73K
p32modA2
p32modA-His
pBADmodA2
pBADmodA2-R72K
pBADmodA2-E165D
relevante Eigenschaften (Resistenz)
allgemeiner Klonierungsvektor (Amp)
allgemeiner Klonierungsvektor (Amp)
Expressionsvektor mit T7 Promotor (Amp)
Expressionsvektor mit T7 Promotor (Amp)
Expressionsvektor, Fusionsprotein mit GST (Amp)
Expressionsvektor mit T7 Promotor und lac Operator
(Amp)
Expressionsvektor mit T7 Promotor und lac Operator, Nterminaler His-Tag (Amp)
Expressionsvektor mit T7 Promotor und lac Operator,
Signalsequenz für Periplasma (Amp)
Expressionsvektor mit T7 Promotor und lac Operator,
Fusionsprotein mit Trx, C-terminaler His-Tag (Amp)
Exprimiert T7 Lysozym als Inhibitor für T7 Polymerase
(Cam)
Exprimiert „Bacteriocin Release Protein“ (Tet)
Expressionsvektor mit araBAD Promotor und Nterminalen His-Tag (Amp)
Exprimiert GroEL und GroES (Cam)
Exprimiert DnaK (Tet)
pKWIII mit T4 Promotor p13.149 (Amp)
pKWIII mit T4 Promotor p8.182 (Amp)
pKWIII mit Promotor ptac (Amp)
Exprimiert gpAlt des Bakteriophagen T4 (Kan)
pET-11d mit modA kloniert über NcoI und BamHI
(Mutation M125→K) (Amp)
pET-11d mit modB kloniert über NcoI und BamHI (Amp)
pET-11d mit modB kloniert über NcoI (Amp)
pET-22b mit modB kloniert über NcoI und BamHI (Amp)
pET-16b mit modA kloniert über BamHI, N-terminaler
His-Tag (Amp)
pET-16b mit modB kloniert über NdeI und BamHI, Nterminaler His-Tag (Amp)
p16modA7 mit Mutation E165→D (Amp)
p16modA7 mit Mutation R72→K (Amp)
p16modB1 mit Mutation E173→D (Amp)
p16modB1 mit Mutation R73→K (Amp)
pET-32b mit modA kloniert über NcoI und XhoI als TrxFusionsprotein (Amp)
p32modA2 ohne NdeI Schnittstelle in modA und ohne trx
Anteil (Amp)
pBAD/His B mit modA über XhoI und HindIII kloniert
(Amp)
pBADmodA2 mit Mutation R72→K (Amp)
pBADmodA2 mit Mutation E165→D (Amp)
Referenz
SHORT et al., 1988
TABOR & RICHARDSON,
1985
SMITH & JOHNSON, 1988
STUDIER & MOFFATT, 1986
ROSENBERG et al., 1987
STUDIER et al., 1990
DUBENDORFF & STUDIER,
1991
LA VALLIE et al., 1993
STUDIER, 1991
VAN DER WAL et
al., 1995
GUZMAN et al., 1995
GOLOUBINOFF et al., 1989
BLUM et al., 1992
WILKENS & RÜGER, 1996
KOCH et al., 1995
diese Arbeit
diese Arbeit
diese Arbeit
diese Arbeit
diese Arbeit
diese Arbeit
diese Arbeit
diese Arbeit
diese Arbeit
diese Arbeit
diese Arbeit
diese Arbeit
diese Arbeit
diese Arbeit
diese Arbeit
15
Material und Methoden
Dra II
Xho I
Kpn I
Eag I
Bgl II
Not I
Nde I
Hin dIII
Xmn I
Acc I
Cla I
Hin cII
Sal I Nde I
T7 Ter f1
Sac I Xba I
Eco RI Cla I
trxA
II
Bam HIDra
T7 Pro
Eco RV
Nco I
Amp
Xmn I
Sca I
Pvu I
Pst I
pET-32b(+)
5899 bps
lacI
Apa I
Bss HII
Eco RV
lacI
Bam HI
Dra II
Eco RV
Nco I
Hin dIII
Xba I
Cla I
Bgl II
Eco RI
Dra II
Dra II
lac operator
Xmn I
T7 Pro
Sca I
Pvu I
Pst I
Amp
pET-11d
Pvu II
Pvu II
5674 bps
Apa I
ori pBR322
Bss HII
Hin cII
Pvu II
Pvu II
Acc I
Pvu II
Xmn I
Dra II
Eco RI
Cla I
Hin dIII
Eco RV
Dra II
Bam HI
Xho I
Dra II
Nde I
Xmn I
Nco I
Sca I
Bgl II
Pvu I
MCS
Dra II
His-Tag
Pst I
T7 Pro
Amp
Apa I
lacI
Dra II
Dra II
Afl III
Bam HI
Nco I
Nhe I
Xmn I
pBAD
MCS
pBAD/His B
Rsa I
Bam HI
Sac I
Xho I
Bgl II
Pst I
Pvu II
Kpn I
Rsa I
Nde I
Eco RI
Hin dIII
4094 bps
ori pBR322
Eag I
Acc I
Pvu II
Xmn I
Bss HII
Ssp I
Rsa I
I
Rsa
Eco RV
araC
5711 bps
Bss HII
Eco RV
Pvu II
Pvu II
Abb. 2.1:
Dra II
Dra II
Nsi I
Bss HII
pET-16b(+)
ori pBR322
Eag I
Acc I
Pvu II
Xmn I
Acc I
Rsa I
Nde I
Afl III
Amp
ColE1
Xmn I
Hin cII
Sca I
Rsa I
Pvu I
Die Abbildung gibt die wichtigsten, in dieser Arbeit verwendeten,
Expressionsvektoren wieder.
16
Material und Methoden
2.4.2 Oligonukleotide (Primer)
Tabelle 2.1
Die angegebenen Oligonukleotide wurden für die PCR, zum Sequenzieren oder für
die Mutagenese eingesetzt. Die farbig hervorgehobenen Basen geben entweder
eingefügte Restriktionsschnittstellen für die gerichtete Klonierung oder
Basenaustausche für die Mutagenese wieder.
Name
1018 (PstI)
1021 (BglII)
modA (EcoRV)
7-5Vorn
7-5Hinten
modBAnf
modBEnde
modAAnf
modAEnde
modBEndBam
modAEndBam
modBNde
modABam
Seq-AP
Seq-AT
Seq-BP
Seq-BT
Mut-A-E165→D1
Mut-A-E165→D2
Mut-B-E173→D1
Mut-B-E173→D2
Mut-A-R72→K1
Mut-A-R72→K2
Mut-B-R73→K1
Mut-B-R73→K2
T7-Promotor
modANcoIAnf
modAXhoIEnd
Mut-A-Nde1
Mut-A-Nde2
modAAnfXhoI
modAEndHindIII
Sequenz
TTCTGCAGTATACGGAGG
TAATGAGATCTAAGTCCTTCC
CGGAGGATATCATGATTATT
AATTCTCATGTTTGACAGCT
GGCTTATCGAAATTAATACG
ACGGAGGCTACCATGGTTATTAAT
CACCGATGCATCCATGGATTTTAT
TGAGGTAGTTCCATGGAATACTCA
GCTTTAAAACTTCCATGGTATAATGA
GCACCGATGGATCCATTGATTTTA
TGGTATAATGGATCCAAGTCCTTC
ACGGAGGCTCATATGATTATTAAT
TTGAATGAAGGATCCAGTAATGCA
AAACCAGATGACCATTCTTG
CAAGAATGGTCATCTGGTTT
GAATGAAGCTCTTCATAAGC
GCTTATGAAGAGCTTCATTC
GAACAAGACGTAATGATA
TATCATTACGTCTTGTTC
GAACAAGACTGGATGATT
AATCATCCAGTCTTGTTC
CTTTGGAAAGGTGTTCCA
TGGAACACCTTTCCAAAG
CAATTATATAAAGGTATATCA
TGATATACCTTTATATAATTG
TAATACGACTCACTATAGGG
ATTGAGGTAGTTCCATGGAATACTCAG
AGTCCTTCCACTCGAGATTAAATCCTTC
CGTATCAGCTTCTTATGATAAAAATATAG
CTATATTTTTATCATAAGAAGCTGATACG
GGTAGTTGCTCGAGATACTRCAGTAATGC
GGTATAATGAATCTAAAAGCTTCCATTATAG
17
Material und Methoden
2.4.3 Bakterienstämme
Stamm
BL21
Genotyp
E. coli B
F- dcm ompT hsdS(rB- mB-) gal
BL21(DE3) E. coli B
F- dcm ompT hsdS(rB- mB-) gal λ(DE3)
BLR
F- ompT hsdSB (rB- mB-) gal dcm ∆(srlrecA)306::Tn10(TetR)
BLR(DE3) F- ompT hsdSB (rB- mB-) gal dcm ∆(srlrecA)306::Tn10(TetR) λ(DE3)
C41(DE3) nicht näher definierte Mutante von BL21 (DE3)
C43(DE3) nicht näher definierte Mutante von BL21 (DE3)
DH5αF'
F'Φ80d lacZ∆M15, recA1, endA1, gyrA96, thi1, hsdR17 (rK-, mK+), supE44, relA1, deoR,
∆(lacZYA-argF)U169
ED8739
F- metB supE supF hsdS (rK12- mK12-)
JM103
JM109
LE392
LMG194
MV1190
XL-1 Blue
endA1 supE sbcBC thi-1 strA ∆(lac-pro) [F'
traD36 lacIqZ∆M15 proAB] (P1 lysogen)
e14-(McrA-) recA1 endA1 gyrA96 thi-1
hsdR17(rK- mK+) supE44 relA1 ∆(lac-proAB)[F'
traD36 proAB lacIqZ∆M15]
F- hsdR514 (rK12- mK12+) mcrA supE44 supF58
lacY1 oder ∆(lacIZY) galK2 galT22 metB1
trpR55
F- ∆lacX74 gal E thi rpsL ∆phoA (PvuII)
∆ara714 leu::Tn10 (TetR StrR)
∆(lac-proAB) thi supE ∆(srlrecA)306::Tn10(Tet)R [F':traD36 proAB
lacIq∆M15]
recA1 endA1 gyrA96 thi-1 hsdR17 supE44 relA1
lac [F' proAB lacIqZ∆M15 Tn10 (TetR)]
Firma
Stratagene
Referenz
STUDIER &
MOFFATT, 1986
Stratagene
Novagen
Novagen
Stratagene
Novagen
Stratagene
MIROUX &
WALKER, 1996
WOODCOCK et al.,
1989
BORCK et al., 1976
STUDIER &
MOFFATT, 1986
HANAHAN, 1983
Stratagene
YANISCH-PERRON
et al., 1985
Novagen
MANIATIS et al.,
1982
Invitrogen
Stammsammlung
Stratagene
BULLOCK et al.,
1987
2.4.4 Bakteriophagen
Phage
λCE6
mGP1-2
Eigenschaft
Enthält Gen für T7 RNA-Polymerase
Enthält Gen für T7 RNA-Polymerase
Referenz
STUDIER & MOFFATT, 1986
TABOR & RICHARDSON, 1985
18
Material und Methoden
2.5 Arbeiten mit Bakterien
2.5.1 Anzucht von Bakterien
Nähr- und Lagermedien
LB-Medium
1
% (w/v)
0,5
% (w/v)
1
% (w/v)
pH 7,5
SOC-Medium
2
% (w/v)
0,5
% (w/v)
10
mM
2,5
mM
10
mM
10
mM
20
mM
pH 7,5
Bacto-Pepton
Hefeextrakt
NaCl
Bacto-Pepton
Hefeextrakt
NaCl
KCl
MgCl2
MgSO4
Glucose
2x YT-Medium
1,6
% (w/v)
1
% (w/v)
0,5
% (w/v)
pH 7,5
Bacto-Pepton
Hefeextrakt
NaCl
Trypton-Phosphat-Medium (MOORE et al., 1993)
2
% (w/v) Bacto-Pepton
1,5
% (w/v) Hefeextrakt
0,2
% (w/v) Na2HPO4
0,1
% (w/v) KH2PO4
0,8
% (w/v) NaCl
vor Gebrauch 0,2 % Glucose dazu
RM-Medium + Glucose
1
x
M9 Salze
2
% (w/v) Casaminosäuren
0,2
% (w/v) Glucose
1
mM
MgCl2
für 1 Liter 20 g Casaminosäuren in
890 ml A.dest. autoklavieren,
dann 100 ml
10 x M9 Salze
1 ml
1 M MgCl2
10 ml
20 % Glucose
10 x M9 Salze
60
g
Na2HPO4
30
g
KH2PO4
5
g
NaCl
10
g
NH4Cl
ad 900 ml A.dest.
pH 7,4
M9-Medium
100 ml
10
ml
10
ml
100 ml
750 ml
Lösung 3
0,2 g
CaCl2 x 2 H2O
ad 100 ml A. dest.
Lösung 1
Lösung 2
Lösung 3
Lösung 4
steriles A. dest.
Lösung 1
20
g
Glucose
ad 500 ml A. dest.
Lösung 2
2,5
g
MgSO4 x 7 H2O
ad 100 ml A. dest.
Lösung 4
35 g
Na2HPO4 x 2 H2O
15 g
KH2PO4
2,5 g
NaCl
5 g
NH4Cl
ad 500 ml A. dest.
pH 7,4
19
Material und Methoden
β-Galaktosidase-Medium
8
g
LAB-Lemco Broth
4
g
NaCl
10
g
Casaminosäuren
5
g
Pepton
ad 1 Liter A. dest.
pH 7,5
Lager-Medium
0,3
% (w/v)
0,7
% (w/v)
0,05 % (w/v)
0,01 % (w/v)
55
% (w/v)
KH2PO4
K2HPO4
Na-Citrat
MgSO4
Glyzerin
Für die Herstellung von Festplattenagar wurden den entsprechenden Medien 1,5 % (w/v)
Bacto-Agar zugegeben. Zur Selektion von plasmidtragenden Bakterien wurden den
Medien entsprechende Antibiotika zugesetzt.
Festplattenmedien mit ADP-Ribosyltransferase Inhibitoren
Manchem
selektiv
3-Methoxybenzamid
Festplattenagar
(m-Anisamid)
wurden
für
spezifische
Inhibitoren
poly-ADP-Ribosyltransferasen
wie
bzw.
1H,3H-Chinazolin-2,4-dion (Benzoylenharnstoff) für mono-ADP-Ribosyltransferasen in
Konzentrationen von 2 mM zugesetzt (BANASIK & UEDA, 1994). Abb. 2.2 gibt die
Strukturformeln der verwendeten Inhibitoren wieder.
O
CH3O
CONH2
NH
N
3-Methoxybenzamid
(m-Anisamid)
Abb. 2.2
O
1H,3H-Chinazolin-2,4-dion
(Benzoylen-Harnstoff)
Strukturformeln der ADP-Ribosyltransferase Inhibitoren 3-Methoxybenzamid
und 1H,3H-Chinazolin-2,4-dion.
Verfahren zur Anzucht der Bakterien
Die Anzucht von Übernacht-Kulturen erfolgte in Reagenzgläsern mit 5 ml Flüssigmedium,
je nach Versuchsvorgaben bei 30° C bis 37° C auf einem Inkubationsroller bei 220 Upm.
20
Material und Methoden
2.5.2 Transformation in Escherichia coli
2.5.2.1 Herstellung kompetenter Zellen für die Elektrotransformation
Es wurden 2 x 200 ml 2x YT-Medium in 1000 ml Erlenmeyerkolben mit 2 ml einer
frischen Übernacht-Kultur der entsprechenden Bakterien angeimpft und bei 37° C auf
einem Schüttler bis OD590 von 0,5 - 0,8 inkubiert. Anschließend verblieben die Zellen 15 –
30 min auf Eis und wurden weiterhin kalt gehalten. Die Zellen wurden bei 4000 x g für 15
min bei 4° C sedimentiert (Sorvall RC-5, GSA Rotor). Der Überstand wurde vollständig
entfernt und die Zellen in 200 ml eiskalten A. dest. gewaschen. Nach erneuter
Zentrifugation folgte ein weiterer Waschschritt mit 100 ml eiskaltem A. dest. und
Zentrifugation. Die Bakterien wurden nun in 4 ml 10 % Glyzerin aufgenommen und auf je
vier 2 ml Eppendorfgefäße verteilt. Nach einer Zentrifugation für 15 min bei 4° C und
3000 x g (Biofuge 15R, Rotor #3042) wurden die Bakterien in je 125 µl 10 % Glyzerin
suspendiert, in Aliquots zu 40 µl in flüssigem Stickstoff schockgefroren und bei –80° C
gelagert.
2.5.2.2 Elektrotransformation
Die elektrokompetenten Zellen wurden vorsichtig aufgetaut und zusammen mit der zu
transformierenden DNA in eine eisgekühlte Elektroporationsküvette (0,2 cm; Peqlab,
Erlangen) gegeben. Enthielt die DNA-Lösung Salze, mußte sie vorher auf einem
Nitrozellulosefilter (0,025 µm Porengröße, 13 mm ∅, Millipore, Erlangen) dialysiert
werden. Die Elektrotransformation (Gen Pulse II, BioRad) erfolgte bei 2,5 kV, 25 µF und
200 Ω. Nach erfolgtem Stromstoß lag die Zeitkonstante bei ca. 5 msec. Anschließend
wurden die Bakterien mit 1 ml SOC-Medium (2.5.1) versetzt und für 30 – 60 min bei
37° C auf einem Schüttler inkubiert. Je nach eingesetzter DNA Menge wurden 50 – 200 µl
der Bakteriensuspension auf entsprechende Selektivmedien ausplattiert.
2.5.2.3 Herstellung hitzeschockkompetenter Zellen mittels CaCl2
Zur Herstellung hitzeschockkompetenter Zellen wurden 400 ml LB-Medium 1 %ig mit
einer frischen Übernacht-Kultur angeimpft und bei 37° C auf einem Schüttler bis OD590
von ca. 0,375 inkubiert. Nach einer 10 minütigen Inkubation auf Eis wurden die Zellen für
7 min bei 4° C und 1600 x g (Sorvall RC-5, GSA Rotor) sedimentiert und die Zellen in
40 ml CaCl2-Lösung (60 mM CaCl2, 15 % (w/v) Glyzerin, 10 mM MOPS) suspendiert.
Nach einer weiteren Zentrifugation für 5 min bei 4° C und 1100 x g wurden die Zellen
21
Material und Methoden
noch einmal in 40 ml CaCl2-Lösung aufgenommen und 30 min auf Eis inkubiert, wieder
für 5 min sedimentiert und anschließend in 8 ml CaCl2-Lösung suspendiert. Die nun
kompetenten Zellen wurden in Aliquots zu je 100 µl aufgeteilt und bei –80° C gelagert.
2.5.2.4 Hitzeschocktransformation
100 µl der hitzeschockkompetenten Zellen wurden mit der zu transformierenden DNA
vermischt und 10 min auf Eis inkubiert. Anschließend erfolgte der Hitzeschock für 2 min
bei 42° C. Danach wurde 1 ml LB-Medium (2.5.1) zu den Bakterien gegeben. Die
phänische Expression erfolgte für 1 Stunde bei 37° C auf einem Inkubationsroller. Je nach
eingesetzter DNA wurden 50 – 200 µl der Bakteriensuspension auf entsprechende
Selektivmedien ausplattiert.
2.5.3 Überexpression von Proteinen in Escherichia coli
2.5.3.1 Überexpression mit λ-Phage CE6
Herstellung von λCE6 Stocklösungen
Der Wirtsstamm für die Vermehrung des λCE6 muß supF exprimieren, damit die Sam7
Lysismutation im Phagen unterdrückt wird. Als Wirtsbakterien wurden somit die Stämme
ED8739 oder LE392 verwendet, die in 10 ml LB-Medium (2.5.1) mit 0,2 % Maltose und
10 mM MgSO4 angezogen wurden bis sie eine OD600 von 1 erreicht hatten. Danach
wurden 5 ml der Wirtszellen mit 2 x 108 Phagenpartikeln gemischt und bei 37° C für 15
min ohne zu schütteln inkubiert. Das Bakterien/Phagen-Gemisch wurde in 500 ml LBMedium mit 10 mM MgSO4 überführt und bei 37° C mit 250 Upm auf einem Schüttler
inkubiert bis die Zellen lysiert waren (ca. 5 Stunden). Danach wurden 5 ml Chloroform
zugegeben und weitere 10 min geschüttelt. Anschließend wurden die Zelltrümmer bei
10.000 x g und 4° C für 10 min sedimentiert. Nach Zugabe von 7 % (v/v) DMSO
Endkonzentration zu der Phagensuspension konnte diese bei –70° C gelagert werden.
Induktion der Überexpression mit λCE6
BL21 Zellen mit dem zu exprimierenden Plasmid wurden in LB-Medium mit 0,2 %
Maltose und entsprechendem Antibiotikum bei 37° C auf einem Schüttler angezogen bis
die OD600 zwischen 0,6 und 1 lag. Danach wurde MgSO4 zu einer Endkonzentration von
10 mM und λCE6 zu einer Endkonzentration von 2 – 4 x 109 pfu/ml („MOI“ 5-10)
zugegeben. Außerdem mußte 1 mM IPTG Endkonzentration verabreicht werden, um den
22
Material und Methoden
T7 Promotor auf den pET-Vektoren zu öffnen. Die infizierten Zellen wurden für weitere
drei Stunden inkubiert und anschließend durch Zentrifugation geerntet.
2.5.3.2 Überexpression mit M13-Phage mGP1-2
Herstellung von mGP1-2 Stocklösungen
Der Wirtsstamm für die Vermehrung von mGP1-2 muß F' sein und einen Amber
Suppressor tragen (z.B. JM103, JM109 oder MV1190). Die Wirtsbakterien wurden in
50 ml 2x YT-Medium bei 37° C bis zu einer OD590 = 0,1 angezogen, mit einem
Einzelplaque von mGP1-2 infiziert und 5 – 8 Stunden weiter inkubiert. Nach einer
Sedimentation der Zellen wurden zu den 50 ml Phagensuspension 3,5 g PEG 6000 gegeben
und die Phagen gefällt.
Induktion der Überexpression mit mGP1-2
MV1190 Zellen mit dem zu exprimierenden Plasmid wurden in 5 ml LB-Medium mit dem
entsprechenden Antibiotikum über Nacht bei 37° C angezogen. Von der Übernacht-Kultur
wurden 100 ml LB-Medium 1 %ig angeimpft, entsprechendes Antibiotikum zugegeben
und die Zellen bei leichtem Schütteln bis OD590 = 0,5 inkubiert. Danach wurden die Zellen
mit mGP1-2 infiziert („MOI“ ~ 10) und 1 mM IPTG Endkonzentration zugegeben, um die
Expression von den pET-Vektoren zu starten. Nach 1,5 bis 3 Stunden konnten die Zellen
geerntet werden.
2.5.3.3 Überexpression mit DE3 Stämmen
Zur Überexpression der Proteine aus
pET-Vektoren
wurden
hauptsächlich
Bakterienstämme benutzt, die durch einen λ-lysogenen Phagen das Gen der T7 RNA
Polymerase im Genom integriert haben (BL21(DE3); BLR(DE3); C41(DE3); C43(DE3)
(2.4.3)). Einige dieser Stämme enthielten ebenfalls das Plasmid pLysS, das für T7
Lysozym kodiert, was einen natürlichen Inhibitor der T7 RNA Polymerase darstellt
(MOFFATT & STUDIER, 1987; STUDIER, 1991; ZHANG & STUDIER, 1997). In Abb. 2.3 sind
die Kontrollelemente des pET Systems wiedergegeben.
Für die Überexpression wurden die Zellen mit dem entsprechenden Plasmid unter
Selektionsdruck in verschiedenen Medien angezogen (LB-, 2x YT-, M9-, TryptonPhosphat-Medium (2.5.1)). Die Anzucht erfolgte bei Temperaturen zwischen 16° C und
23
Material und Methoden
45° C auf einem Schüttler bei 200 Upm. Bei Erreichen einer OD590 von 0,8 wurde die
Überexpression mit 0,5 - 1 mM IPTG Endkonzentration gestartet. Je nach verwendetem
Bakterienstamm wurden die Zellen für 0,5 – 16 Stunden weiter inkubiert. Die Zellen
wurden durch Zentrifugation (Sorvall RC-5B; Rotor GSA; 4000 x g, 20 min, 4°C)
geerntet, in Aufschlußpuffer (2.5.5) suspendiert und bei –20° C bis zur Weiterverarbeitung
gelagert.
Abb. 2.3:
Kontrollelemente des pET Systems (nach Novagen, verändert).
2.5.3.4 Überexpression aus pBAD-Vektoren
Zur Überexpression aus pBAD-Vektoren wurde der E. coli Stamm LMG194 (2.4.3)
verwendet. Die mit dem entsprechenden pBAD-Plasmid transformierten Zellen wurden
unter Selektionsdruck in RM-Medium + Glucose oder β-Galaktosidase-Medium (2.5.1) bis
OD600 = 0,5 bei 37° C und 200-250 Upm auf einem Schüttler angezogen. Die Induktion
erfolgte mit 0,00002 % bis 0,2 % L-Arabinose Endkonzentration. Die induzierten Zellen
wurden nach 4 Stunden durch Zentrifugation (Sorvall RC-5B; Rotor GSA; 4000 x g, 20
min, 4°C) geerntet, in Aufschlußpuffer (2.5.5) suspendiert und bei –20° C bis zur
Weiterverarbeitung gelagert. In Abb. 2.4 ist eine schematische Darstellung der Regulation
des pBAD Promotors wiedergegeben.
24
Material und Methoden
AraC Dimer
keine Transkription
+ Arabinose
Transkription
Abb. 2.4:
Regulation des pBAD Promotors.
C: Carboxyterminus des AraC; N: Aminoterminus des AraC; O2, I1, I2:
Bindestellen für AraC; CAP: (CAP)-cAMP Komplex; Pc: araC Promotor
2.5.3.5 Überexpression in Gegenwart von Bakteriocinfreisetzungsprotein
Das Plasmid pSW1 kodiert für das Bakteriocinfreisetzungsprotein BRP („bacteriocin
release protein“) dessen Bildung durch Zugabe von Mitomycin C induziert werden kann
(VAN
DER
WAL et al., 1995). Durch die Coexpression des BRP mit dem gpModA bzw.
gpModB sollten diese in das Medium freigesetzt und die Bildung von Einschlußkörpern
verhindert werden.
Cotransformanden mit pSW1 und entsprechenden pET-Vektoren in BL21(DE3) bzw.
BLR(DE3) wurden von einer Übernacht-Kultur 1 %ig in 1x YT-Medium mit 15 µg/ml
Tetracyclin und 100 µg/ml Ampicillin angeimpft. Anschließend wurden die Zellen bei
37° C auf einem Schüttler inkubiert. Bei Erreichen einer OD590 von 0,6 wurde die
Expression des BRP durch Zugabe von 10 – 300 ng/ml Endkonzentration Mitomycin C
induziert. 30 min später erfolgte die Induktion der pET-Vektoren mit 1 mM IPTG
Endkonzentration. Die Expression wurde für weitere 3 Stunden fortgesetzt, die Zellen
sedimentiert und der Proteinanteil im Überstand und den Zellen in einem SDSPolyacrylamidgel (2.7.2) analysiert.
2.5.3.6 Coexpression von Chaperonen bei der Überexpression
Weitere Versuche zur Vermeidung von Einschlußkörpern schlossen die Coexpression von
Chaperonen ein. Dazu wurden die Plasmide pGroESL (GOLOUBINOFF et al., 1989) und
pBN19 (BLUM et al., 1992a; 1992b) verwendet. Das Plasmid pGroESL kodiert für die
25
Material und Methoden
Hitzeschockproteine GroES und GroEL während pBN19 für das HSP70 Chaperon DnaK
kodiert.
Für die Überexpression wurden Cotransformanden der pET-Vektoren mit pGroESL bzw.
pBN19 in BL21(DE3) verwendet. Die Anzucht erfolgte bei 37° C auf einem Schüttler bis
zu einer OD590 von 0,6 - 0,8. Die Coexpression wurde durch Zugabe von 1 mM IPTG
Endkonzentration induziert und die Zellen für 3 Stunden weiter inkubiert. Anschließend
wurden die Zellen geerntet, aufgeschlossen und der Gehalt an löslichen bzw. unlöslichen
Proteinen auf SDS-Polyacrylamidgelen (2.7.2) analysiert.
2.5.4
Plasmidstabilitätstest der pET-Vektoren und Modifikationen des
Testverfahrens
2.5.4.1 Plasmidstabilitätstest der pET-Vektoren
Kurz vor der Induktion der pET-Vektoren kann man die Kultur auf den Anteil der
Bakterien untersuchen, die das Plasmid noch tragen und exprimieren können. Dazu wurden
Verdünnungen der Bakterien auf unterschiedliche Agar-Platten ausplattiert, siehe Tabelle
2.2. Für diesen Test wurden die Stämme BL21(DE3) und BLR(DE3) verwendet.
Tabelle 2.2:
Übersicht über die verwendeten Agar-Platten im Plasmidstabilitätstest und die zu
erwarteten Kolonienzahlen.
LB-Agar-Platte
Verdünnung
erwartetes
Wachstum in %
Wachstum von
ohne Zusatz
2 x 10-4
100
alle Zellen
mit 100 µg/ml Amp
2 x 10-4
100
Zellen mit Plasmid
mit 1 mM IPTG
10-3
<2
mit 100 µg/ml Amp
und 1 mM IPTG
10-3
< 0,01
Zellen ohne Plasmid oder
Mutanten, die die Ziel-DNA
nicht mehr exprimieren können
Mutanten, die die Ziel-DNA
nicht mehr exprimieren können
2.5.4.2 Schnellüberprüfung auf Expressionsfähigkeit der Transformanden
Der Plasmidstabilitätstest (2.5.4.1) konnte leicht modifiziert auch zur Schnellüberprüfung
auf die Expressionsfähigkeit von Transformanden herangezogen werden. Dazu wurden die
Transformanden in einem Raster auf LB-Agar mit 100 µg/ml Ampicillin und auf LB-Agar
mit 100 µg/ml Ampicillin und 1 mM IPTG übertragen. Die Transformanden, die nicht auf
dem IPTG haltigen Agar wuchsen wurden von dem Ampicillin haltigen Agar für die
Überexpression angeimpft.
26
Material und Methoden
2.5.4.3 Schnellüberprüfung der Toxizität von ModA und ModB sowie deren Mutanten
Eine weitere Modifikation des Plasmidstabilitätstests (2.5.4) konnte Hinweise über die
Toxizität von ModA, ModB und deren Mutanten geben. Für diesen Test wurde der Stamm
C41(DE3) (MIROUX & WALKER, 1996) verwendet. Dieser Stamm ist eine nicht näher
definierte Mutante von BL21(DE3) und hat die Fähigkeit unter induzierten Bedingungen
auf Agar-Platten zu wachsen, da entweder die Prozessivität oder die Menge der gebildeten
T7 RNA Polymerase verringert ist.
Zur Überprüfung der Toxizität wurden die zu untersuchenden Plasmide in C41(DE3)
transformiert und auf Selektiv-Agar und Selektiv-Agar mit 1 mM IPTG ausplattiert.
2.5.5 Aufschluß von Bakterien und Reinigung von Einschlußkörpern
Die aus einer 500 ml Expressionskultur geernteten Bakterien (ca. 2,5 g) wurden in 10 –
30 ml Aufschlußpuffer suspendiert und entweder mit Ultraschall (Branson Sonifier B-12,
bei 100 W) auf Eis für 6 mal 30 sec oder mit der French Presse (Cell Typ 40 K) bei
2000 psig aufgeschlossen.
Nach erfolgtem Aufschluß wurden die Einschlußkörper bei 3000 x g (Sorvall RC-5, GSA
Rotor) für 20 min bei 4° C von den Zellresten und den löslichen Proteinen getrennt. Die
Einschlußkörper
wurden
anschließend
in
30
ml
„Inclusionbody“-Waschpuffer
resuspendiert und 30 min auf Eis mit gelegentlichem vortexen inkubiert. Nach einer
weiteren Sedimentation der Einschlußkörper bei 10.000 x g für 20 min bei 4°C konnten
diese dann entweder im Aufschlußpuffer mit 6 M GuHCl oder im „Inclusionbody“Denaturierungspuffer aufgelöst werden. Schwer lösliche Bestandteile wurden durch eine
Zentrifugation bei 20.000 x g für 30 min sedimentiert oder die Lösung durch einen 0,45
µm Filter gegeben.
Aufschlußpuffer
50 mM
NaH2PO4
300 mM
NaCl
10 mM
Imidazol
pH 8,0
nach dem Autoklavieren
frisch dazu:
1
mM
DTT
2
mM
PMSF
„Inclusionbody“-Waschpuffer (HLODAN et al., 1991)
50
mM
Tris-HCl pH 7,5
2
mM
EDTA
100
mM
NaCl
1
M
Harnstoff
0,05
% (w/v) Deoxycholatsäure
1
mM
DTT
1
mM
PMSF
0,5
mg/ml
Lysozym
27
Material und Methoden
„Inclusionbody“-Denaturierungspuffer
100 mM
Tris
2
M
Harnstoff
pH 12,0
2.6 Arbeiten mit DNA
2.6.1 Methoden der Plasmidisolierung
Zur Isolation von Plasmid-DNA aus E. coli wurden diverse Plasmid Isolations Kits der
Firmen Qiagen (Hilden), Macherey-Nagel (Düren) und Promega (Madison USA) unter
Befolgung der entsprechenden Protokolle verwendet.
Des weiteren wurde die Methode von BIRNBOIM & DOLY (1979) oder zur Schnellisolation
von Plasmid-DNA die Methode von GOODE & FEINSTEIN (1992) eingesetzt.
2.6.2 Enzymatische Modifikationen von Plasmid-DNA
Enzymatische Modifikationen von Plasmid-DNA wie Restriktionsverdau, Ligation,
Dephosphorylierung, S1-Verdau, Mungbohnen Nuklease-Verdau und Modifikationen mit
dem Klenow-Fragment erfolgten nach den Angaben der entsprechenden Enzymhersteller
(Gibco BRL, Neu-Isenburg; MBI Fermentas, St. Leon-Rot; Boehringer, Mannheim) oder
nach AUSUBEL et al. (1993).
2.6.3 Polymerase Kettenreaktion (PCR)
Zur Amplifikation der Gene modA und modB aus dem T4 Genom wurde die Polymerase
Kettenreaktion verwendet. Es wurde T4 DNA verwendet, die nicht das 5-HydroxymethylCytosin sondern Cytosin beinhaltet (Cyt-DNA aus T4 alc563 [42- (amC87), 56- (amE51),
denB- (amS19), alc (unf39)]. Die PCR wurde in einem Mini-Cycler (Biozym) nach
folgendem Standard Protokoll durchgeführt:
1)
2)
3)
4)
5)
30 sec
2 min
1 min
gehe zu 1)
10 min
95° C
5° - 10° C unter der Schmelztemperatur der Primer
72° C
35 mal
72° C
28
Material und Methoden
Die Reaktionsansätze setzten sich im Allgemeinen folgendermaßen zusammen:
Komponente
T4 Cyt-DNA (XhoI-hydrolysiert) 10 ng/µl
10 x Puffer
je 2,5 mM dNTP´s
50 mM MgCl2
Anfang-Primer (10 pmol/µl)
Ende-Primer (10 pmol/µl)
Taq-Polymerase 2 U/µl
A. dest.
µl
2
10
10
5
5
5
1
62
2.6.4 Mutagenese
Die ortsspezifische Mutagenese der Gene modA und modB erfolgte mit dem
„QuikChange Site-Directed Mutagenesis Kit“ von Stratagene. Dabei wurden die unter
2.4.2 aufgeführten Mutageneseprimer (Mut...) verwendet. Die Mutagenese erfolgte in
einem Mini-Cycler (Biozym) in Anlehnung des Herstellers. Da die Mutageneseprimer
laut Angabe von Stratagene eine zu niedrige Schmelztemperatur haben, wurde das PCRProtokoll wie folgt geändert:
1)
2)
30 sec
1 min
2 min
3)
4)
13 min
gehe zu 1)
95° C
40° C
↓
68° C
68° C
16 mal
Nach erfolgter Mutagenese wurde das methylierte, nicht mutierte Parental-DNA Template
durch DpnI hydrolysiert. Die verbliebenen mutagenisierten Plasmide wurden in E. coli
XL1-Blue transformiert und auf Selektiv-Medium ausplattiert. Zur Überprüfung der
erfolgreichen Mutagenese wurden die Plasmide isoliert und sequenziert (2.6.1; 2.6.7).
2.6.5 Agarose-Gelelektrophorese
Die Auftrennung von DNA-Fragmenten erfolgte je nach Größe der zu trennenden
Fragmente in 0,6 – 1,5 % (w/v) Agarose in TAE-Puffer mit 0,5 µg/ml Ethidiumbromid.
Die Gelelektrophorese fand in einer horizontalen Elektrophoresekammer (9 x 10 cm) bei
80 mA für 0,5 – 2 Stunden statt. Vor dem Auftragen der Proben wurden diese mit
entsprechenden Mengen 10 x DNA-Probenpuffer versetzt. Als Größenstandards wurde
EcoRI/HindIII-verdaute λ-DNA und eine 100 bp Plus Leiter eingesetzt (2.3).
29
Material und Methoden
10 x TAE-Puffer
400 mM Tris-HCl pH 7,6
10 mM Essigsäure
2
mM EDTA
10 x DNA-Probenpuffer
25
% (w/v) Glyzerin
0,05
% (w/v) Bromphenolblau
in TAE-Puffer
2.6.6 Isolierung von DNA-Fragmenten aus Agarosegelen
Die Isolierung von DNA-Fragmenten aus Agarosegelen erfolgte mittels des „QIAquick
Gel Extraction Kit“ (Qiagen, Hilden) nach Angaben des Herstellers.
2.6.7 DNA-Sequenzierung nach SANGER et al. (1977)
Die DNA Sequenzierung erfolgte mit den „T7 Sequencing Mixes“ (Pharmacia, Freiburg)
unter Einsatz von α[35S]dATP nach Angaben des Herstellers. Die Auftrennung der
Reaktionsgemische erfolgte in 6 %igen Polyacrylamidgelen (290 x 600 x 0,35 mm) mit
7 M Harnstoff in 1,2 x TBE-Puffer. Als Laufpuffer dienten der Anoden-Puffer (0,6 x TBE)
und der Kathoden-Puffer (0,6 x TBE, 90 mM Na-Phosphat). Die Proben wurden bei 35 W
für 2,5 Stunden bzw. 5,5 Stunden aufgetrennt, das Gel auf Whatman Papier gezogen und
auf einem Geltrockner getrocknet. Anschließend erfolgte eine Exposition mit einem
Röntgenfilm für 1 bis 2 Tage.
10 x TBE-Puffer
0,89 M
Tris
0,83 M
Borsäure
25 mM EDTA
pH 8,3
2.7 Arbeiten mit Proteinen
2.7.1 Bestimmung von Proteinkonzentrationen
colorimetrisch nach BRADFORD (1976)
Die
Bestimmung
der
Proteinkonzentrationen
von
Proteingemischen
erfolgte
photometrischen nach der Methode von BRADFORD (1976). Dazu wurden 1-20 µl der
Probe mit A. dest. auf 200 µl gebracht, mit 2 ml Bradfordreagenz versetzt und 10 min im
Dunkeln inkubiert. Die Messung erfolgte bei einer OD595 und die Proteinkonzentration
wurde nach einer mit Rinderserumalbumin erstellten Eichgeraden ermittelt.
30
Material und Methoden
Bradfordreagenz
10 % (v/v)
Phosphorsäure
5%
(v/v)
Ethanol
0,01 % (w/v)
Coomassie Brillantblau G-250
spektroskopisch
Die Bestimmung der Proteinkonzentrationen von gereinigten Proteinen erfolgte bei einer
OD280. Die benötigten Werte (1A280= ) zur Berechnung der jeweiligen Konzentrationen
wurden dem Programm Protean aus dem DNAStar Programmpaket entnommen.
2.7.2 SDS-Polyacrylamid-Gelelektrophorese
Die Auftrennung von Proteinen erfolgte in einem diskontinuierlichen Gelsystem (MiniPROTEANII) nach LAEMMLI (1970) nach Angaben des Herstellers. Für die Auftrennung
der Proteine wurden 4 %ige Sammelgele und 10 - 15 %ige Trenngele, je nach
Versuchsziel, verwendet. Die Proben wurden mit 5 x SDS-Probenpuffer versetzt und für 5
bis 10 min gekocht. Die Elektrophorese erfolgte im Tris-Glycin Laufpuffer bei 200 V für
50 min. Anschließend wurden die Gele mit Coomassie Brillantblau (2.7.2.1) oder Silber
(2.7.2.2) gefärbt.
Sammelgel (4 %)
0,5 ml
Rotiphorese 29:1 (40 %)
1,25 ml
4 x Sammelgelpuffer
3,25 ml
A. dest.
25 µl
20 % (w/v) SDS
25 µl
10 % (w/v) APS
10 µl
TEMED
Trenngel (13 %)
3,25 ml
Rotiphorese 29:1 (40 %)
2,5 ml
4 x Trenngelpuffer
4,25 ml
A. dest.
40 µl
20 % (w/v) SDS
40 µl
10 % (w/v) APS
20 µl
TEMED
4 x Sammelgelpuffer
0,5 M
Tris-HCl pH 6,8
5 x SDS-Probenpuffer
100 mM
Tris
50
% (w/v) Glyzerin
25
% (v/v) β-Mercaptoethanol
15
% (w/v) SDS
0,01 % (w/v) Bromphenolblau
pH 6,8
4 x Trenngelpuffer
1,5 M
Tris-HCl pH 8,8
Tris-Glycin Laufpuffer
25 mM
Tris
190 mM
Glycin
0,1 % (w/v) SDS
31
Material und Methoden
2.7.2.1 Coomassie Brillantblau Färbung
Nach der Gelelektrophorese wurden die Gele für 5 – 15 min in der Coomassie-Färbelösung
gefärbt und mit der Entfärbelösung der Gelhintergrund bis zum gewünschten Grad
entfärbt.
Coomassie-Färbelösung
45
% (v/v) Methanol
9
% (v/v) Eisessig
0,25 % (w/v) Coomassie Brillantblau
Entfärbelösung
30 % (v/v) Methanol
7,5 % (v/v) Eisessig
2.7.2.2 Silberfärbung
Zur Silberfärbung von Proteingelen wurde die Methode nach BLUM et al. (1987) verändert
von NESTERENKO et al. (1994) angewendet. Dazu wurde das Trenngel 5 min im Fixierer
inkubiert, mit ddH20 gespült (3 x 5 sec; 1 x 5 min; 3 x 5 sec). Nach einer Vorbehandlung
mit 50 % Azeton für 5 min und 1 min in der Na2S2O3-Lösung wurde erneut mit ddH2O
gespült (3 x 5 sec). Die Färbung erfolgte für 8 min in der Färbelösung. Nach erfolgter
Spülung mit ddH2O (2 x 5 sec) wurde das Gel für 10 – 20 sec im Entwickler entwickelt
und die Reaktion durch Austausch der Lösung gegen 1 % Essigsäure gestoppt.
Fixierer
60 ml
1,5 ml
25 µl
50 % (v/v) Azeton in ddH2O
50 % (w/v) TCA in ddH2O
37 % Formaldehyd
Färbelösung
0,16 g
AgNO3
0,6 ml
37 % Formaldehyd
60 ml
ddH2O
Na2S2O3-Lösung
100 µl
10 % (w/v) Na2S2O3 in ddH2O
60 ml ddH2O
Entwickler
1,2 g
25 µl
25 µl
60 ml
NaCO3
37 % Formaldehyd
10 % (w/v) Na2S2O3 in ddH2O
ddH2O
2.7.3 Aufreinigung von „His-Tag“-Proteinen
Die Proteine ModA und ModB, sowie deren modifizierte Varianten, wurden durchweg als
Einschlußkörper synthetisiert und lagen nur zu einem nicht mehr detektierbaren Anteil
löslich im Cytoplasma vor. Die Reinigung der Proteine erfolgte aus den Einschlußkörpern
(2.5.5) unter denaturierenden Bedingungen im Aufschlußpuffer mit 6 M GuHCl (2.5.5).
Renaturierte Proteine wurden unter nativen Bedingungen über eine immobilisierte
Metallchelat-Affinitätschromatographie gereinigt.
32
Material und Methoden
2.7.3.1 Immobilisierte Metallchelat-Affinitätschromatographie
Zur Reinigung der „His-Tag“ Proteine wurde die von PORATH et al. (1975; PORATH, 1992)
eingeführte immobilisierte Metallchelat-Affinitätschromatographie (IMAC) verwendet.
Hier wird die hohe Affinität von aufeinanderfolgenden Histidinen (6-10 Stück) zu
zweiwertigen Ionen ausgenutzt. Die gebundenen Proteine können anschließend mit
Imidazol oder bei pH 6,0 eluiert werden.
•
Reinigung unter denaturierenden Bedingungen
Zum Einsatz kamen die Säulenmaterialien Ni-NTA (Nickel-Nitrilotriessigsäure, Qiagen),
Talon (Co2+ beladen, Clontech) und His•Bind Resin (Novagen). Die Handhabung der
Säulenmaterialien erfolgte nach Angaben des jeweiligen Herstellers mit 2 ml
Säulenmaterial in 5 ml Polypropylen-Säulen. Nach erfolgter Äquilibrierung der Säule mit
5 Säulenvolumen (SV) Aufschlußpuffer mit 6 M GuHCl erfolgte die Bindung der Proteine
an das Säulenmaterial nach dem „Batch-Verfahren“ bei Raumtemperatur (RT). Nachdem
die Säule mit 5 SV Aufschlußpuffer mit 8 M Harnstoff gewaschen war erfolgte die
Renaturierung der gebundenen Proteine auf der Säule. Dazu wurden 4 SV
Renaturierungspuffer mit 6 M Harnstoff, 4 SV Renaturierungspuffer mit 3 M Harnstoff bei
RT und 5 SV Renaturierungspuffer bei 4° C über die Säule gegeben. Die Elution der
Proteine erfolgte mittels eines Imidazol-Stufengradienten (50 – 300 mM) im
Aufschlußpuffer in 50 mM Schritten. Die gesammelten Fraktionen (0,5 bis 1 SV) wurden
mit Hilfe eines SDS-Polyacrylamidgels auf ihren Proteingehalt hin analysiert, die
entsprechenden Fraktionen vereinigt und gegen Dialyse-Puffer 1 oder Dialyse-Puffer 2
dialysiert.
Aufschlußpuffer
50 mM
NaH2PO4
300 mM
NaCl
10 mM
Imidazol
pH 8,0
Renaturierungspuffer
20
mM
Tris
500 mM
NaCl
20
% (v/v) Glyzerin
2
mM
red. Glutathion
0,2
mM
oxi. Glutathion
0,5
mM
PMSF
pH 7,4
33
Material und Methoden
Dialyse-Puffer 1
10 mM
Tris-HCl
1
mM
EDTA
50 % (v/v) Glyzerin
pH 8,0
•
Dialyse-Puffer 2
50
mM
500 mM
1
mM
10
mM
40
% (v/v)
Tris-Acetat
NH4Cl
EDTA
β-Mercaptoethanol
Glyzerin
Reinigung unter nativen Bedingungen
Für die Reinigung unter nativen Bedingungen wurde die Ni-NTA Matrix (Qiagen) nach
Angaben des Herstellers verwendet. Als zu reinigendes Proteingemisch wurden unter
pH 12,0 denaturierte und anschließend über Dialyse renaturierte Einschlußkörper (2.7.4.2)
verwendet. Die gesamte Reinigung erfolgte bei 4° C. 2 ml Säulenmaterial wurden mit
Lysis-Nativ-Puffer äquilibriert, das Proteingemisch über die Säule gegeben und diese mit
6 SV Lysis-Nativ-Puffer gespült. Die Elution der gebundenen Proteine erfolgte mit je 5 SV
Qia-Elute-Puffer mit 50 mM, 80 mM, 100 mM und 250 mM Imidazol. Es wurden
Fraktionen von 2 ml gesammelt und auf einem SDS-Polyacrylamidgel auf ihren
Proteingehalt analysiert. Geeignete Fraktionen wurden vereinigt und gegen DialysePuffer 2 über Nacht dialysiert. Anschließend wurden die Proteine bei –20° C gelagert.
10 x Lysis-Nativ-Puffer
500 mM
NaH2PO4
3
M
NaCl
100 mM
Imidazol
pH 8,0
10 x Qia-Elute-Puffer
500 mM
NaH2PO4
3
M
NaCl
pH 8,0
2.7.4 Renaturierung von Proteinen
Da die Bindung der Proteine unter denaturierenden Bedingungen an den oben erwähnten
Säulenmaterialien
(2.7.3.1)
nicht
sehr
effektiv
war
wurden
alternative
Renaturierungsmethoden angewendet.
2.7.4.1 Renaturierung durch Verdünnung
Bei dieser Methode wurden die im Aufschlußpuffer mit 6 M GuHCl (2.5.5) gelösten
Einschlußkörper langsam in 100 ml Renaturierungspuffer 2 bei RT unter ständigem
Rühren getropft. Anschließend wurden die Proteine durch Zentrifugationsfiltration
(Ultrafree-15
Centrifugal
Filter
Device
Biomax-10K,
Millipore,
Eschborn)
aufkonzentriert.
34
Material und Methoden
Renaturierungspuffer 2
50
mM
Tris-HCl pH 8,0
100 mM
Glycin
0,5
% (v/v) Triton X-100
0,01 % (v/v) Tween 20
20
% (v/v) Glyzerin
100 mM
Mg-Acetat
100 mM
KCl
0,5
mM
PMSF
15
mM
β-Mercaptoethanol
2.7.4.2 Renaturierung durch Dialyse
• Die im Aufschlußpuffer mit 6 M GuHCl (2.5.5) aufgelösten Einschlußkörper wurden
auf eine Proteinkonzentration von 1 mg/ml gebracht. Die Dialyse erfolgte in
Dialyseschläuchen mit einer Ausschlußgröße von 12 - 16 kDa (Dialysemembran
Type20, Biomol, Hamburg) gegen 1 Liter Dialyse-Renaturierungs-Puffer mit
stufenweiser Verringerung der Harnstoffkonzentration (6 M → 4 M → 2 M → 0 M).
Dialyse-Renaturierungs-Puffer
100
mM
NaH2PO4
10
mM
Tris
50
mM
Glycin
100
mM
KCl
2
mM
MgCl2
0,005 % (v/v) Tween 20
0,5
mM
PMSF
pH 8,0
•
Die
im
„Inclusionbody“-Denaturierungspuffer
(2.5.5)
aufgenommenen
Einschlußkörper wurden auf eine Proteinkonzentration von 1 mg/ml bzw. 3 mg/ml für
die Trx-Fusionsproteine gebracht. Die Dialyse erfolgte in Dialyseschläuchen mit einer
Ausschlußgröße von 12 - 16 kDa (Dialysemembran Type20, Biomol, Hamburg) gegen
1 Liter Lysis-Puffer über Nacht bei 4° C.
Lysis-Puffer
50
mM
300 mM
2
M
pH 8,0
NaH2PO4
NaCl
Harnstoff
35
Material und Methoden
2.7.5
Transfer von Proteinen auf Polyvinylidenfluorid (PVDF)-Membranen
(Western Blot)
Die in einem SDS-Polyacrylamidgel aufgetrennten Proteine wurden in einer Mini-TransBlot-Kammer (BioRad) auf eine PVDF-Membran übertragen. Dazu wurde die PVDFMembran 5 sec in Methanol getaucht, 2 min mit A. dest. abgespült und 2 – 3 min im
Towbin-Puffer äquilibriert. Der Blot wurde wie in Abb. 2.5 zusammengesetzt und in der
Blot-Kammer fixiert. Nach Zugabe des eiskalten Towbin-Puffers erfolgte die Übertragung
der Proteine auf die Membran für 15 min bei 150 mA und 30 min bei 300 mA. Nach
erfolgtem Transfer konnten die rekombinanten „His-Tag“ Proteine mit einem Ni-NTAKonjugat nachgewiesen werden (2.7.6).
Towbin-Puffer (TOWBIN et al., 1979)
25
mM
Tris
192 mM
Glycin
20
% (v/v) Methanol
Abb. 2.5
Schematische Anordnung der Western-Blot Apparatur.
36
Material und Methoden
2.7.6 Nachweis von rekombinanten „His-Tag“ Proteinen
Zum Nachweis der rekombinanten „His-Tag“ Proteine wurde das „Ni-NTA HRP
Konjugat“ der Firma Qiagen verwendet. Das Ni-NTA mit der gekoppelten MeerrettichPeroxidase (Horseradish Peroxidase, HRP) erlaubt die Detektion der rekombinanten
Proteine anhand von Chemilumineszenz, die zur Schwärzung eines Röntgenfilmes
eingesetzt wird.
Nach erfolgtem Transfer der Proteine auf die PVDF-Membran (2.7.5) wurde diese der
Reihe nach 2 mal 10 min in TBS-Puffer, eine Stunde im Blocking-Puffer, 3 mal 10 min in
TBS-Tween-Puffer, eine Stunde in TBS-Tween-Puffer mit Ni-NTA-Konjugat-Stocklösung
(1:1000 verdünnt) und 3 mal 10 min in TBS-Tween-Puffer inkubiert.
Danach wurde die Membran mit 1 ml ECL (Amersham, Braunschweig) überschichtet und
in durchsichtige Folie eingeschlagen. Die Detektion der „His-Tag“ Proteine erfolgte mit
einem Röntgenfilm, der für 5 – 20 sec auf der Folie exponiert wurde.
Nach erfolgter Detektion konnten die Proteine auf der PVDF-Membran mittels der
Coomassie Brillantblau Färbung sichtbar gemacht werden (2.7.2.1).
TBS-Puffer
10 mM
150 mM
Tris-HCl pH 7,5
NaCl
TBS-Tween-Puffer
20
mM
Tris-HCl pH 7,5
500 mM
NaCl
0,05 % (v/v) Tween 20
Blocking-Puffer
3
% (w/v) RSA
in TBS-Puffer
2.8 ADP-Ribosyltransferase Aktivitätstest
2.8.1 Aktivitätstest mit 32P-NAD+
Die ADP-Ribosyltransferase Aktivität der gpModA und gpModB sowie deren modifizierte
Varianten wurde in einem leicht veränderten ADP-Ribosyltransferasetest nach ROHRER et
al. (1975) ermittelt. Die Versuchsansätze setzten sich im Allgemeinen wie in Tabelle 2.3
beschrieben zusammen. Alle Reaktionen fanden in einem Volumen von 100 µl für 30 min
bei 15° C statt. Nach erfolgter Inkubation wurden die Proteine mit 40 µl 50 %iger (w/v)
Trichloressigsäure gefällt und die Proteine durch ein Zentrifugation (13.000 Upm, 10 min,
RT) sedimentiert. Das Sediment wurde anschließend mit 70 % (v/v) Azeton gewaschen
37
Material und Methoden
(Zentrifugation für 5 min bei RT), getrocknet, in 80 µl SDS-Probenpuffer aufgenommen
und 15 min gekocht. Ein Aliquot von 15 – 20 µl wurde auf einem SDS-Polyacrylamidgel
aufgetrennt (2.7.2), das Gel mit Coomassie Brillantblau gefärbt (2.7.2.1) und getrocknet.
Das getrocknete Gel wurde dann mit einem Röntgenfilm und Verstärkerfolien bei –80° C
für 2 Tage bis 4 Wochen exponiert.
Tabelle 2.3 Allgemeine Zusammensetzung des ADP-Ribosyltransferase Aktivitätstests.
lösliche Proteine aus BLR (DE3) (100 µg)
10 x Transferasepuffer
32
P-NAD+ (1 µCi )
E. coli RNA-Polymerase (20 µg optional)
ADP-Ribosyltransferase (5 – 10 µg gereinigtes Enzym oder 100 µg
lösliches Protein einer Überexpression)
10 x Transferasepuffer
500 mM
Tris-Acetat pH 7,5
100 mM
Magnesium-Acetat
220 mM
NH4Cl
10 mM
EDTA
10 mM
β-Mercaptoethanol
2.8.2 Bestimmung der ADP-Ribosyltransferase Aktivität mit p-Nitrobenzylidinaminoguanidin (NBAG)
Zur Bestimmung der KM und Vmax Werte von gpModA wurde die photometrische Methode
von SOMAN et al. (1983) angewendet. Dabei wurde die ADP-Ribosylierung von NBAG
(2.8.2.1) durch die kontinuierliche Absorptionszunahme bei 370 nm über einen Zeitraum
von einer Stunde bei RT gemessen. Eine Änderung der Absorption um 0,1 Einheiten
entspricht dabei einer Menge von 5 x 10-2 µmol Produkt in 1 ml Reaktionsansatz. Die
allgemeine Zusammensetzung der Reaktionsgemische ist Tabelle 2.4 zu entnehmen.
Tabelle 2.4:
Allgemeine Zusammensetzung des NBAG-Tests.
0,4 M Tris-Acetat pH 7,4
160 mM DTE
ADP-Ribosyltransferase
A. dest.
25 mM NAD+
20 mM NBAG in 36 mM DTE
A. dest.
50 µl
200 µl
30 – 100 µg
ad 400 µl für 10 – 30 min
vorinkubieren
0 – 400 µl
0 – 20 µl
ad 1000 µl
38
Material und Methoden
2.8.2.1 Herstellung von p-Nitrobenzylidin-aminoguanidin (NBAG)
Das p-Nitrobenzylidin-aminoguanidin wurde in Anlehnung an das Protokoll von BAIOCCHI
et al. (1963) für die Synthese von Guanylhydrazone hergestellt.
Eine 0,11 M Lösung von Aminoguanidin Bicarbonat (in 125 ml A. dest.) wurde mit HCl
angesäuert (pH 5 – 6) und auf 60° C erwärmt. Eine gleiche molare Menge
p-Nitrobenzaldehyd (in 100 ml Ethanol) wurde unter Rühren zugegeben und 16 Stunden
bei RT weiter gerührt. Die Feststoffe wurden in einem Rotationsverdampfer gesammelt
und in Ethanol bei 60° C bis zur Sättigungsgrenze gelöst. Die bei der Abkühlung
entstandenen Kristalle stellten das gewünschte NBAG dar (Rekristallisation). Abb. 2.6 gibt
die Strukturformeln der eingesetzten Chemikalien wieder, sowie deren Farbgebungen in
Lösung.
O
O
NH
HO
OH H2N
N
O
O
p-Nitrobenzaldehyd
(in Lösung gelb)
N
H
NH2
Aminoguanidin Bicarbonat
(in Lösung klar)
NH
O
N
N
O
N
H
NH2
p-Nitrobenzylidin-aminoguanidin (NBAG)
(in Lösung rötlich)
Abb. 2.6
Strukturformeln von p-Nitrobenzaldehyd, Aminoguanidin Bicarbonat und dem
synthetisiertem p-Nitrobenzylidin-aminoguanidin, sowie deren Farbgebung in Lösung.
2.9 Transkriptionsversuche
Für die Transkriptionsversuche wurde die von U. Aschke-Sonnenborn nach der Methode
von BURGESS & JENDRISAK (1975) isolierte E. coli RNA-Polymerase eingesetzt.
Um Veränderungen im Transkriptionsverhalten der unveränderten und durch ModA
modifizierten E. coli RNA-Polymerase festzustellen wurden Transkriptionsversuche
unternommen. Für die Versuche wurden pKWIII Plasmide mit dem artifiziellen Promotor
ptac und den frühen T4-Promotoren p8.182 und p13.149 verwendet. Außerdem wurde die
39
Material und Methoden
Transkription von genomischer T4-Wildtyp DNA (isoliert von U. Aschke-Sonnenborn)
und genomischer E. coli DNA (isoliert mit NucleoSpin C+T) untersucht.
2.9.1 Transkription von pKWIII Plasmiden
Die in vitro Transkription von den pKWIII Plasmiden erfolgte in Form einer
zeitabhängigen Kinetik. Dazu wurden 7,2 pmol Gesamtvektor bzw. 0,36 pmol der über
PvuII herausgeschnittenen Promotoren verwendet. Die Transkription erfolgte über 60 min
bei RT in einem 500 µl Ansatz (Tabelle 2.5) wobei nach 0, 5, 10, 15, 20, 30, 40, 50 und 60
min je ein Aliquot von 50 µl des Ansatzes mit 150 µl 20 mM EDTA gestoppt wurde. Um
den Einfluß von ModA auf die Transkription zu untersuchen wurde 10 min nach dem
Reaktionsstart ModA zum Ansatz zugegeben. Die einzelnen Aliquots wurden anschließend
auf DE81 Filter (Whatman) gesaugt und diese 3 mal in 0,5 M NaH2PO4, pH 7,0 gewaschen
(pro Filter 5 ml). Zur Bestimmung der eingebauten Radioaktivität wurden die getrockneten
Filter in 5 ml Szintilationsflüssigkeit gegeben und die Radioaktivität auf den Filtern in
einem Szintilationszähler bestimmt.
Tabelle 2.5:
Allgemeiner Reaktionsansatz für die in vitro Transkription von pKWIII Plasmiden.
pKWIII Plasmid bzw.
Promotorfragment
7,2 pmol
0,36 pmol
10 x RNA-Polymerase-Puffer
50 µl
RNase-Inhibitor (50 U/µl)
50 U
ADP-Ribosyltransferase ModA
+
NAD (25 mM)
5 µl
E. coli RNA-Polymerase
0,36 pmol (173 ng)
ad 420 µl
A. dest.
3 NTP-Mix (ATP, CTP, GTP) (je 5 mM)
UTP (1 mM)
32
α P-UTP (10 µCi/µl)
10x RNA-Polymerase-Puffer
400 mM
Tris-HCl pH 8,0
100 mM
MgCl2
500 mM
KCl
5
mM
DTT
0,5 mg/ml
RSA
10 – 500 ng
40 µl
37,5 µl
2,5 µl
Szintilationsflüssigkeit
5
g 2,5-Diphenyloxazol (PPO)
0,22 g 1,4-Bis(5 phenyl-2 oxazoyl) benzen
(POPOP)
1
Liter
Toluol
ad
40
Material und Methoden
2.9.2 Transkription von genomischer DNA
Die Transkriptionsversuche von genomischer DNA erfolgten mit isolierter E. coli RNAPolymerase und mit löslichen Gesamtzellextrakten. Für die löslichen Gesamtzellextrakte
wurden E. coli Zellen unter induzierten Bedingungen mit den Plasmiden pET16b(+)
(Kontrolle), p16modA7 (gpModA) und pTKRI (gpAlt) bis zu einer OD590 von 0,65 bei
37° C auf einem Schüttler angezogen. Durch die Anzucht der Bakterien unter induzierten
Bedingungen sollte die E. coli RNA-Polymerase durch die Genprodukte ModA bzw. Alt
ADP-ribosyliert vorliegen. Die Reaktionen erfolgten in 50 µl Ansätzen, deren allgemeine
Zusammensetzung der Tabelle 2.6 zu entnehmen ist. Die Transkription erfolgte für 30 min
bei 37° C und wurde anschließend mit 150 µl 20 mM EDTA gestoppt. Die Ansätze wurden
auf DE81 Filter (Whatman) gesaugt und wie unter 2.9.1 beschrieben weiter behandelt.
Tabelle 2.6:
Allgemeiner Reaktionsansatz für die Transkription von genomischer DNA.
T4-Wildtyp DNA bzw. E. coli DNA
2 µg
10 x RNA-Polymerase-Puffer (2.9.1)
5 µl
RNase-Inhibitor (50 U/µl)
10 U
NAD+ (25 mM)
0,5 µl
RNA-Polymerase bzw.
60 - 173 ng
löslicher Proteinrohextrakt
30 – 110 µg
A. dest.
3 NTP-Mix (ATP, CTP, GTP) (je 5 mM)
ad 42 µl
4 µl
UTP (1 mM)
3,75 µl
α32P-UTP (10 µCi/µl)
0,25 µl
41
Ergebnisse
3 Ergebnisse
Nach den „Threading-Experimenten“ sollten die beiden unbekannten Leserahmen für
ADP-Ribosyltransferasen kodieren. Es soll an dieser Stelle vorweggenommen werden, daß
sich im Laufe der Arbeit gezeigt hat, daß beide Polypeptide ADP-Ribosyltransferasen sind.
Dabei kodiert der zweite Leserahmen für die bereits bekannte ADP-Ribosyltransferase
Mod, die nun als ModA bezeichnet wird. In Anlehnung daran wurde das zweite Protein als
ModB bezeichnet (Abb. 3.1).
N d eI E c o R I
H in dIII
m o d A (20 0 a a , 2 3.3 k D a)
m o d B (20 7 a a , 2 4.2 k D a)
1 2 .5 1 3 k b
1 3 .1 3 3 k b
P 1 3 .1 49
Abb. 3.1
11 .9 1 3 k b
ATGA
P 11 .8 1 5
Anordnung der Leserahmen von modB und modA zwischen den Promotoren
P13.149 und P11.815. Die Angaben in kb entsprechen den Positionen auf der
genomischen Karte des T4.
3.1 Computergestützte Auswertung der Proteinsequenzen von ModA und ModB
Die folgenden Angaben über die rekombinanten Proteine ModA, His-ModA, ModB und
His-ModB wurden mit dem Programm Protean aus dem DNAStar Paket ermittelt.
A
B
His-ModA Analyse
20
40
60
80
100
120
His-ModB Analyse
140
160
180
200
220
20
Faktor Xa (Protease)
40
60
80
100
120
140
160
180
200
220
Faktor Xa (Protease)
A
Alpha, Regionen - Chou-Fasman
A
Alpha, Regionen - Chou-Fasman
B
Beta, Regionen - Chou-Fasman
B
Beta, Regionen - Chou-Fasman
T
Turn, Regionen - Chou-Fasman
T
Turn, Regionen - Chou-Fasman
A
Alpha, Regionen - Garnier-Robson
A
Alpha, Regionen - Garnier-Robson
B
Beta, Regionen - Garnier-Robson
B
Beta, Regionen - Garnier-Robson
T
Turn, Regionen - Garnier-Robson
T
Turn, Regionen - Garnier-Robson
C
Coil, Regionen - Garnier-Robson
C
Coil, Regionen - Garnier-Robson
3
0
3
Hydrophobizitäts Plot - Hopp-Woods
-3.4
G
hydrophobe Regionen - Hopp-Woods
hydrophile Regionen - Hopp-Woods
G
hydrophobe Regionen - Kyte-Doolittle
W
0
hydrophile Regionen - Hopp-Woods
Hydrophobizitäts Plot - Kyte-Doolittle
G
hydrophobe Regionen - Kyte-Doolittle
4.5
Hydrophilizitäts Plot - Kyte-Doolittle
-4.5
Abb. 3.2
Hydrophilizitäts Plot - Hopp-Woods
-4.5
4.5
W
hydrophobe Regionen - Hopp-Woods
4.5
Hydrophobizitäts Plot - Kyte-Doolittle
-4.5
0
0
-3.4
4.5
0
G
3
Hydrophilizitäts Plot - Hopp-Woods
-3.4
W
Hydrophobizitäts Plot - Hopp-Woods
-3.4
3
0
0
0
Hydrophilizitäts Plot - Kyte-Doolittle
-4.5
hydrophile Regionen - Kyte-Doolittle
W
hydrophile Regionen - Kyte-Doolittle
Vorhersagen über die Sekundärstrukturen und die Verteilung hydrophober und
hydrophiler Bereiche innerhalb der Proteine His-ModA (A) und His-ModB (B).
Dargestellt sind die Verteilungen dieser Regionen über die Aminosäurekette nach den
Algorithmen von CHOU & FASMAN (1978), GARNIER & ROBSON (1978), HOPP &
WOODS (1981) sowie KYTE & DOOLITTLE (1982).
42
Ergebnisse
Außerdem weisen beide Proteine noch eine potentielle Glykosylierungsstelle auf. Bei
ModA liegt diese bei Aminosäure Leu34 und bei ModB bei Aminosäure Tyr131.
Tabelle 3.1:
Einige wichtige Eckdaten der Proteine ModA, His-ModA, Trx-ModA, ModB und
His-ModB.
ModA
His-ModA
Trx-ModA
Molekulargewicht:
23.349,50 Da 25.947,10 Da 41.434,10 Da
Länge in Aminosäuren:
200
222
366
1 A280 =
0,95 mg/ml
1,12 mg/ml
1,07 mg/ml
isoelektrischer Punkt:
6,04
6,53
5,95
Ladung bei pH 7,0:
- 2,49
- 3,49
-11,04
ModB
His-ModB
24.244,5 Da
207
0,94 mg/ml
5,31
- 7,16
26.766,10 Da
228
1,04 mg/ml
6,41
- 5,16
Die Übereinstimmung in der Aminosäuresequenz von ModA und ModB beträgt 25 %
identische bzw. 47 % homologe Aminosäuren (Abb. 3.3).
Abb. 3.3
3.2
Alignment der Aminosäuresequenzen von ModA und ModB. Es werden 25 %
identische und 47 % homologe Aminosäuren gefunden. (nach CuraBLASTP über den
Curatools Server (ALTSCHUL et al., 1990))
Klonierung der beiden offenen Leserahmen zwischen den T4 Promotoren
p11.815 und p13.149
3.2.1 Klonierungsversuche in die Vektoren pBluescript II KS/SK
Zur Klonierung der beiden offenen Leserahmen wurden die Gene einzeln über eine PCR
aus dem T4 Genom amplifiziert (2.6.3). Die benutzten Primer enthielten zur gerichteten
Klonierung in die Vektoren entsprechende Schnittstellen für Restriktionsendonukleasen.
Die Klonierung der Gene sollte zum Einen in Richtung des lacZ-Gens und zum Anderen
entgegen der Leserichtung von lacZ erfolgen. Keiner dieser Klonierungsversuche war
erfolgreich, was zu der Überzeugung führte, daß beide Genprodukte eine toxische Wirkung
auf E. coli haben müssen, zumal es kein Problem darstellte Teilsequenzen bis 2/3 der Gene
43
Ergebnisse
in diese Vektoren zu klonieren. Da die pBluescript Vektoren von der E. coli RNAPolymerase gut abgelesen werden können (Blau/Weiß-Selektion) zeigen sie eine hohe
Transkriptionsrate der lacZ Region. Versucht man hier ein Gen zu klonieren, dessen
Genprodukt toxisch ist, wird dieses sofort transkribiert und translatiert, so daß es zu keiner
Vermehrung der Bakterien kommt.
Aus diesem Grund sollten die nächsten Klonierungsversuche mit Expressionsvektoren
durchgeführt werden, deren klonierte Gene unter der Kontrolle eines T7 Promotors stehen,
der nicht von der E. coli RNA-Polymerase erkannt wird. Eine weitere Option war es, ein
Fusionsprotein zu generieren. Es bestand die Möglichkeit, daß durch die Fusion mit einem
anderen Protein die Toxizität der beiden Zielproteine stark eingeschränkt sein könnte.
3.2.2 Klonierungsversuche in die Vektoren pT7-5 und pT7-6
Die Amplifikation der beiden Gene erfolgte wieder unabhängig voneinander mittels PCR.
Für die gerichtete Klonierung waren ebenfalls Restriktionsschnittstellen durch die Primer
eingefügt worden. Da vor dem zu exprimierenden Gen der T7 Promotor Φ10 liegt, und
dieser nicht von der E. coli RNA-Polymerase erkannt wird, bestand Hoffnung, die Gene
kloniert zu bekommen. Letzten Endes erwiesen sich die Vektoren pT7-5 bzw. pT7-6 aber
auch nicht als geeignet für die Klonierung der beiden Gene. Die „Low-Level“ Expression
in diesen Vektoren ist anscheinend zu hoch.
Bei
TOMASCHEWSKI
(1988)
führte
die
Einführung
einer
Struktur
zur
Transkriptionstermination (poly(dA)•poly(dT)) in den Vektor pT7-6 zum Erfolg der
Klonierung von Gen 49 (Endonuklease VII) aus dem Bakteriophagen T4. SHIGESADA &
IMAI (1982) haben gezeigt, daß eine poly(dA)•poly(dT) Abfolge mit poly(dA) in 5'→3'
Richtung in Gegenwart von ρ (Roh) die Transkription um 64 % hemmt. Deshalb sollte
ebenfalls versucht werden durch die Einführung
einer solchen Struktur
zur
Transkriptionstermination die Klonierung der Gene zu ermöglichen. Dazu wurde in der
PvuII Schnittstelle der Vektoren pT7-5 und pT7-6, die direkt vor dem Φ10 Promotor liegt,
eine poly(dA)•poly(dT) Sequenz eingefügt. Dafür wurde poly(dA)•poly(dT) DNA
(Sigma) mit Ultraschall behandelt und Fragmente von 100 bis 300 bp aus einem
Agarosegel isoliert (2.6.6), die Fragmente mit S1-Nuklease behandelt und in die mit PvuII
geschnittenen und dephosphorylierten Vektoren ligiert. Nach einer Restriktionsanalyse auf
inserierte poly(dA)•poly(dT) DNA wurde durch Sequenzierung die Orientierung dieser
DNA ermittelt. Die Sequenzierung einzelner Klone ergab, einen Einbau von 80 bis 130 bp
44
Ergebnisse
poly(dA)•poly(dT). Die Klone mit der passenden poly(dA) Orientierung wurden für die
weiteren Klonierungsexperimente verwendet (Klone mit Richtiger Orientierung von
poly(dA): pT7-5AT7, 9, 10, 11, 16, pT7-6AT11).
Die Klonierung der beiden Gene in die neu generierten pT7-xAT Vektoren gelang
allerdings
nicht,
was
dafür
spricht,
daß
die
Transkriptionstermination
durch
poly(dA)•poly(dT) nicht effektiv genug ist und eine „Low-Level“ Transkription der beiden
Gene immer noch letal für E. coli ist.
3.2.3 Klonierungsversuche in den Vektor pGEX-3X
Eine andere Idee die Toxizität der Genprodukte zu unterbinden war es ein Fusionsprotein
zu generieren. Es bestand Hoffnung, daß durch die Fusion mit der Glutathion
S-Transferase (GST, 27 kDa) die beiden Mod Proteine (24 kDa bzw. 23 kDa) ihre
Toxizität nicht mehr entfalten können. Dazu wurde der Expressionsvektor pGEX-3X
verwendet, dessen Expression von dem tac-Promotor kontrolliert wird. Die Gene sollten
über die SmaI Schnittstelle des Vektors in den Leserahmen für die GST kloniert werden.
Die Klonierung der beiden Gene in diesen Vektor war ebenfalls nicht möglich.
Anscheinend ist das GST-Fusionsprotein auch toxisch und die „Low-Level“ Expression
unter nicht induzierten Bedingungen von dem induzierbaren tac-Promotor immer noch zu
hoch, was eine Beeinträchtigung des Wachstums von E. coli bewirken könnte.
3.2.4 Klonierungsversuche in die pET-Vektoren
Die Expression von pET-Vektoren unterliegt einer sehr stringenten Kontrolle (2.5.3.3). Die
Zielgene stehen wie bei den pT7-x Vektoren unter der Kontrolle eines starken
Bakteriophagen T7 Promotors. Direkt hinter dem T7 Promotor befindet sich allerdings als
zusätzlicher Transkriptionsschutz der lac Operator, so daß in diesen Vektoren unter nicht
induzierten Bedingungen die Transkription vollständig unterdrückt sein sollte.
Vektor pET-11d
Die Gene sollten zuerst in den Vektor pET-11d kloniert werden, da hier die Proteine in
ihrer ursprünglichen Form ohne größere Modifikation (z.B. Fusion mit anderen
Aminosäuren) exprimiert werden können. Die Gene modA und modB wurden mittels PCR
amplifiziert (Primer: modAAnf – modAEndBam bzw. modBAnf – modBEndBam (2.4.2)).
Die verwendeten Primer enthielten die Erkennungssequenz für die Restriktionsenzyme
NcoI und BamHI, um die PCR-Produkte gerichtet in den Vektor pET-11d zu klonieren.
45
Ergebnisse
Nach erfolgter Transformation in XL1-Blue wurden von einigen Transformanden die
Plasmide isoliert und einer Restriktionsanalyse unterzogen. Zur Identifizierung von
einklonierten modA wurde mit EcoRI und zur Identifizierung von modB mit HindIII die
DNA hydrolysiert.
erwartete Fragmente nach EcoRI-Hydrolyse
pET-11d
p11modAB
5674 bp
5676 bp
578 bp
erwartete Fragmente nach HindIII-Hydrolyse
pET-11d
p11modBB
5674 bp
5729 bp
578 bp
Wie sich zeigte, ist die Transkriptionskontrolle der pET-Vektoren stringent genug, um die
Gene modA bzw. modB zu klonieren. Es wurden die Plasmide p11modAB3 (pET11d,
modA über NcoI und BamHI 3. Klon) und p11modBB5 (pET11d, modB über NcoI und
BamHI 5. Klon) erhalten (Abb. 3.4).
Bam HI
Pvu II
Eco RI
Nde I
Pvu II
Nsi I
Nco I
Xba I
Bgl II
Eco RV
Rsa I
Hin dIII
Bsp 106I
Cla I
Eco RI
modA
T7 Promotor
Amp
Nco I
Xba I
Bgl II
Hin cII
ScaI
Rsa I
Pvu I
Pst I
Bam HI
Rsa I
Rsa I
Hin dIII
Spe I
modB
T7 Promotor
lacI
Bss HII
Eco RV
Hin cII
Pvu II
Pvu II
Abb. 3.4
6254 bps
Rsa I
Apa I
pBR322
Eag I
Amp
Hin cII
ScaI
Rsa I
Pvu I
PstI
p11modBB
p11modAB
Rsa I
Apa I
Eco RV
Rsa I
Hin dIII
Bsp 106I
Cla I
EcoRI
Rsa I
Acc I
Pvu II
lacI
6307 bps
pBR322
Bss HII
Eco RV
Hin cII
Pvu II
Pvu II
Eag I
Rsa I
Acc I
Pvu II
Vektorkarten von p11modAB und p11modBB.
Vektor pET-16b(+)
Um die rekombinanten Proteine ModA und ModB schnell und einfach zu isolieren,
wurden die entsprechenden Gene in den Vektor pET-16b(+) kloniert. Dieser Vektor erlaubt
die Fusion rekombinanter Proteine mit einem N-terminalen „His-Tag“ aus 10 Histidinen.
Das Gen modA wurde wegen einer internen NdeI Schnittstelle über BamHI (Primer:
modABam - modAEndBam (2.4.2)) und das Gen modB über NdeI und BamHI (Primer:
modBNde - modBEndBam (2.4.2)) so in den Vektor pET-16b(+) kloniert, daß ein Nterminales Fusionsprotein mit „His-Tag“ entstand. Nach erfolgter Restriktionsanalyse (wie
bei pET-11d) erhielt man die Klone p16modA7 und p16modB1 (Abb. 3.5).
46
Ergebnisse
Bei der Klonierung von modA hätte das Gen in zwei möglichen Orientierungen in den
Vektor eingebaut werden können (Klonierung nur über eine Schnittstelle). Bei den
Restriktionsanalysen von ca. 20 Klonen fand sich aber kein Klon mit einer inversen
Orientierung des Gens, was evtl. dafür spricht, daß das Gen in inverser Orientierung
abgelesen werden konnte und die Toxizität von gpModA zu tragen kam.
Eco RI
Hin dIII
Rsa I
Eco RV
Bam HI
Pvu II
Eco RI
Nde I
Pvu II
Nsi I
Bam HI
Xho I
Nde I
Nco I
Xba I
Bgl II
His-modA
Ssp I
Hin cII
Sca I
Rsa I
Pvu I
Pst I
Amp
Eco RI
Hin dIII
Rsa I
Eco RV
Bam HI
Rsa I
Rsa I
Hin dIII
Ssp I
Spe I
Nde I
Nco I
Xba I
His-modB
Bgl II
T7 Promotor
Rsa I
Abb. 3.5
6370 bps
pBR322
Rsa I
Acc I
Pvu II
Eag I
Amp
p16modB
lacI
Bss HII
Eco RV
Hin cII
Pvu II
Pvu II
Hin cII
Sca I
Rsa I
Pvu I
Pst I
T7 Promotor
p16modA
6320 bps
Ssp I
Rsa I
pBR322
lacI
Bss HII
Eco RV
Hin cII
Pvu II
Pvu II
Rsa I
Acc I
Pvu II
Eag I
Vektorkarten von p16modA und p16modB.
Vektor pET-22b(+)
Um das toxische gpModB aus dem Cytoplasma zu entfernen, wurde modB in den Vektor
pET-22b(+) über NcoI und BamHI kloniert (Primer: modBAnf – modBEndBam (2.4.2)) es
entstand der Vektor p22modBB2 (Abb. 3.6). Dieser Vektor besitzt die „pelB LeaderSequenz“ für den Proteinexport in den periplasmatischen Raum.
Auf eine Klonierung von modA in diesen Vektor wurde verzichtet (3.8.3).
47
Ergebnisse
Xho I
Eco RV
Eag I
Nco I
Not I
Rsa I
Hin dIII
Rsa I
Sal I
Hin dIII
Hin cII
Spe I
Acc I
Nco I
Sac I Nde I
Eco RI Xba I
modB
Bam HI Bgl II
pelB leader
T7-Promotor
Amp
Rsa I
Pvu I
Pst I
p22modBB
6158 bps
lacI
Rsa I
Apa I
Bss HII
Eco RV
Hin cII
Pvu II
Pvu II
Abb. 3.6
pBR322
Rsa I
Acc I
Pvu II
Vektorkarte von p22modBB.
Vektor pET-32a(+)
Die rekombinanten Mod-Proteine werden ausschließlich als Einschlußkörper exprimiert.
Um dem entgegenzuwirken sollten N-terminale Thioredoxin (Trx)-Fusionsproteine
generiert werden. Dazu wurde das Gen modA nach einer PCR (Primer: modANcoIAnf –
modAXhoIEnd (2.4.2)) über NcoI und XhoI in den Vektor pET-32b(+) kloniert. Die
Restriktionsanalyse erfolgte mit PvuII.
erwartete Fragmente nach PvuII-Hydrolyse
pET-32a(+)
p32modA
4807 bp
2939 bp
2132 bp
999 bp
999 bp
282 bp
93 bp
93 bp
Als exemplarisches Beispiel einer dreifachen Restriktionskontrolle auf das korrekt
klonierte Gen dient Abb. 3.7. Für die Analyse wurden die Restriktionsschnittstellen so
ausgewählt, daß sie zum Einen in dem zu klonierenden Gen und zum Anderen auf dem
Vektor lagen (hier NdeI bzw. PvuII, siehe auch Abb. 3.8). Des weiteren wurde das Insert
über die Klonierungsstellen wieder herausgeschnitten (hier NcoI und XhoI).
48
Ergebnisse
Abb. 3.7
Restriktionsanalyse des Klones p32modA2 auf einem 0,8 %igen Agarosegel.
Erwartete Fragmentgrößen nach Restriktion mit NdeI: 5673 bp, 427 bp, 345 bp;
PvuII: 2939 bp, 2132 bp, 999 bp, 282 bp, 93 bp (aufgrund der geringen Größe nicht
zu sehen); NcoI+XhoI: 5846 bp, 599 bp. Als Größenstandard dienten eine 100 bp
Leiter Plus (links) und λ/EcoRI+HindIII (rechts).
Nach erfolgter Expression erhielt man ein Fusionsprotein mit folgendem Aufbau: Trx6His-ModA-6His also ein Trx-Fusionsprotein mit einem internen und einem C-terminalen
„His-Tag“. Abb. 3.8 gibt die Karte des so generierten Vektors p32modA wieder.
Wahrscheinlich auf Grund der hohen Expressionsrate wurde das Trx-Fusionsprotein aber
immer noch als Einschlußkörper exprimiert (3.8.5).
49
Ergebnisse
Xho I
Pvu II
Eco RI
Nde I
Pvu II
I
Nsi
Nco I
Kpn I
Bgl II
Nde I
Xmn I
Cla I
Nde I
Trx-ModA
Xba I
Cla I
Xmn I
Sca I
Pvu I
Pst I
amp
T7 Promotor
p32modA
6445 bps
lacI
pBR322
Apa I
Bss HII
Hin cII
Pvu II
Pvu II
Abb. 3.8
Acc I
Pvu II
Xmn I
Vektorkarte von p32modA.
3.2.5 Klonierungsversuche in den Vektor pBAD/HisB
Um die Bildung von Einschlußkörpern zu vermeiden, wurde versucht von der starken
Expression, von dem T7 Promotor aus, wegzukommen. Hierfür bot sich der Vektor
pBAD/HisB an. Die Expression klonierter Gene aus dem Vektor pBAD/HisB steht unter
der Kontrolle des regulierbaren, Dosis abhängigen Promotors PBAD. Je nach verabreichter
Menge L-Arabinose kann hier die Genexpression von schwach bis stark reguliert werden.
Außerdem konnte mit diesem Vektor auch eine Fusion mit einem N-terminalen „His-Tag“
erreicht werden.
Das Gen modA wurde mit dem Primerpaar modAAnfXhoI – modAEndHindIII (2.4.2)
amplifiziert und über die Schnittstellen XhoI und HindIII in den Vektor pBAD/HisB
kloniert. Die Restriktionsanalyse erfolgte mit RsaI.
erwartete Fragmente nach RsaI-Hydrolyse
pBAD/HisB
pBADmodA
1565 bp
1565 bp
1464 bp
957 bp
957 bp
848 bp
663 bp
663 bp
44 bp
17 bp
17 bp
Dieser Vektor erwies sich ebenso wie die pET-Vektoren als genügend stringent reguliert,
um die Aufnahme des modA Gens zu tolerieren. Man erhielt somit das Plasmid
50
Ergebnisse
pBADmodA2 (Abb. 3.9). Das Gen modB wurde von F. KAISER im Rahmen seiner
Diplomarbeit (1999) in diesen Vektor kloniert.
Rsa I
Rsa I
Eco RV
araC
Afl III
Bam HI
Nco I
Nhe I
Rsa I
Bam HI
Xho I
Nsi I
pBAD
Pvu II
Nde I
Eco RI
His-modA
Nsi I
pBADmodA
Acc I
Rsa I
Nde I
Afl III
Pvu II
Hin dIII
4666 bps
ColE1
amp
Hin cII
Sca I
Rsa I
Pvu I
Abb. 3.9
Vektorkarte von pBADmodA.
Sämtliche Klone wurden durch Sequenzierung auf Fehler hin überprüft, die bei der PCR
oder beim Klonieren der Gene aufgetreten sein könnten. Dabei erwiesen sich alle Klone bis
auf p11modAB3 als fehlerfrei. Der Klon p11modAB3 weist eine Punktmutation im modA
Gen an der Stelle Met125 auf. Hier ist das entsprechende Codon ATG zu AAG verändert,
was einen Aminosäureaustausch von Methionin nach Lysin (Met125→Lys) bewirkt.
Aktivitätstests und Vergleiche mit dem Ribosylierungsmuster von His-ModA konnten aber
zeigen, daß diese Mutation keinen deutlichen Einfluß auf die Aktivität bzw. auf das
Erkennungsmuster von Zielproteinen hat.
3.3
Anzucht von Transformanden in Gegenwart von ADP-Ribosyltransferase
Inhibitoren
Bei den Klonierungsexperimenten mit den Vektoren pBluescript II KS/SK, pT7-x und
pGEX-3X wurden den Selektivagarplatten teilweise die ADP-Ribosyltransferase
Inhibitoren 3-Methoxybenzamid bzw. 1H,3H-Chinazolin-2,4-dion in Konzentrationen von
2 mM zugesetzt. Diese Inhibitoren sollten die ADP-Ribosylierung von Wirtsproteinen
verhindern und somit den Klonierungserfolg in diese Vektoren ermöglichen. Diese
Maßnahme führte allerdings zu keinem Erfolg, sei es, daß die Substanzen nicht von den
Bakterien aufgenommen wurden, sie abgebaut oder nicht spezifisch genug für ModA bzw.
ModB waren.
51
Ergebnisse
3.4
Identifizierung des Mod-Proteins, das die E. coli RNA-Polymerase
modifiziert
Die ersten Überexpressionsversuche aus den Vektoren p11modAB3 und p11modBB5
wurden mit dem Phagen λCE6 durchgeführt (3.5.1.1). Nach der Überexpression lag der
größte Teil der exprimierten Proteine als Einschlußkörper, also in einer inaktiven Form,
vor. Da aber zu erwarten war, daß ein geringer Prozentsatz als lösliches und somit aktives
Protein vorhanden war, wurden die ersten Aktivitätstests nach ROHRER et al. (1975) (2.8.1)
mit löslichen Proteinüberständen einer Expressionskultur durchgeführt.
Dazu wurden 300 µg löslicher Proteinrohextrakt mit 35 µg gereinigter E. coli RNAPolymerase in Gegenwart von
32
P-NAD+ inkubiert, auf einem SDS-Polyacrylamidgel
aufgetrennt und das mit Coomassie Brillantblau gefärbte und getrocknete Gel auf einem
Röntgenfilm exponiert (Abb. 3.10). Nach Auswertung des Autoradiogramms konnte das
zweite Protein des Leserahmens (hier schon als ModA bezeichnet) als dasjenige
identifiziert werden, das die E. coli RNA-Polymerase modifiziert. Des weiteren konnte
gezeigt werden, daß das andere Protein (bereits als ModB bezeichnet), wie von BAZAN &
KOCH-NOLTE (1997) vorhergesagt, ebenfalls eine ADP-Ribosyltransferase ist. Da nun
bekannt war, daß ModA (definiert als „A“, da dieses Protein zuerst in der Literatur als
Mod beschrieben wurde) die E. coli RNA-Polymerase modifiziert, wurde verstärkt an
diesem Protein weitergearbeitet.
Abb. 3.10
SDS-Polyacrylamidgel (links) und Autoradiogramm (rechts) der ADPRibosylierung von RNAP und löslicher Proteine mit löslichen Rohextrakten einer
Überexpression von ModA und ModB. An der rechten Seite sind die Lauffronten
von den Untereinheiten der RNAP wiedergegeben.
52
Ergebnisse
3.5 Überexpression von Mod
Im Allgemeinen gestaltete sich die Überexpression der Genprodukte ModA und ModB auf
Grund ihrer Toxizität als schwierig. Teilweise neigten die Kulturen der DE3-Stämme dazu,
vor der Induktion der Expression, zu lysieren und Phagen freizusetzen. Um mit weniger
toxisch wirkenden Proteinen zu arbeiten wurden im Laufe dieser Arbeit Mutanten beider
Proteine hergestellt (3.11).
3.5.1 Überexpression aus pET-Vektoren
3.5.1.1 Überexpression mit λCE6
Da die Genprodukte ModA und ModB sehr toxisch für E. coli sind, wurden die ersten
Überexpressionen mit einem λ–Phagen, der das Gen für die T7 RNA-Polymerase trägt
(λCE6) (STUDIER & MOFFATT, 1986) durchgeführt (2.5.3.1). Die Induktion der
Überexpression von selbst hergestellten Phagenstocklösungen erwies sich allerdings als
ineffektiv, so daß für die Überexpression Bakterienstämme eingesetzt wurden, die den
λ-Phagen DE3 lysogen im Genom tragen (3.5.1.3).
3.5.1.2 Überexpression mit mGP1-2
Eine Alternative die T7 RNA-Polymerase in die Wirtsbakterien zu bekommen ist der M13Phage mGP1-2 (STUDIER & MOFFATT, 1986) (2.5.3.2). Mit diesem Phagen ließ sich in F'
Bakterien aber keine Überexpression der gewünschten Genprodukte ModA bzw. ModB
erzielen.
3.5.1.3 Überexpression aus DE3 Stämmen
Zur erfolgreichen Überexpression von gpModA und gpModB wurden DE3 Stämme
eingesetzt (2.5.3.3). Diese E. coli Stämme enthalten den λ-Phagen DE3 lysogen im
Genom, er trägt das lacI Gen, den lacUV5 Promotor und das Gen für die T7 RNAPolymerase.
Zum Einsatz kamen die E. coli Stämme BL21(DE3), BLR(DE3), C41(DE3) und
C43(DE3), die zum Teil das Plasmid pLysS beinhalteten. Dieses Plasmid kodiert für das
T7 Lysozym, einem natürlichen Inhibitor der T7 RNA-Polymerase und sollte deshalb eine
stringentere Kontrolle vor Induktion der Überexpression gewährleisten. Abb. 3.11 zeigt als
53
Ergebnisse
Beispiel eine Überexpression aus p16modA7 in E. coli BL21(DE3), der zusätzlich das
Plasmid pLysS enthielt.
Abb. 3.11
Überexpression von His-ModA (p16modA7) in BL21(DE3) pLysS.
Spur 1: 10 kDa-Leiter
Spur 2: Rohextrakt von Zellen kurz vor der Induktion
Spur 3: Rohextrakt von Zellen 3 Stunden nach Induktion mit 1 mM IPTG
Trotz der stringenten Expressionskontrolle hat der mit den Plasmiden p16modA7 oder
p16modB1
transformierte
Bakterienstamm
BL21(DE3)
unter
nicht
induzierten
Bedingungen einen deutlichen Wuchsnachteil (Abb. 3.12), der auf die klonierten Gene
modA bzw. modB zurückzuführen ist .
2,5
2
1,5
OD590
BL21 (DE3)
pET16b(+)
p16modB1
p16modA7
1
0,5
0
0
0,5
1
1,5
2
2,5
3
3,5
4
4,5
Stunden
Abb. 3.12
Wuchskurven von BL21(DE3) mit den Plasmiden pET16b(+), p16modA7 (ModA)
oder p16modB1 (ModB).
54
Ergebnisse
Der Plasmidstabilitätstest (2.5.4.1) zeigte immer zuverlässig an, ob eine Überexpression
von ModA oder ModB stattgefunden hatte oder nicht. Wuchsen auf den LB-Agarplatten
mit 1 mM IPTG sehr viele Kolonien, vergleichbar mit der LB-Amp-Agarplatte, konnte auf
einem SDS-Polyacrylamidgel auch keine Überexpression nachgewiesen werden. Fanden
sich auf der IPTG-haltigen Platte im Vergleich mit der LB-Amp-Agarplatte wenige
Kolonien (2 - 6%) wurden die rekombinanten Proteine auch immer überexprimiert.
Im Verlauf der Überexpression von gpModA oder gpModB kam es zur Bildung von
Einschlußkörpern. Abb. 3.13 zeigt exemplarisch die Überexpression und die Isolation der
Einschlußkörper von der Mutante His-ModA-R72K aus dem Vektor p16modA7-R72K.
In Abb. 3.14 ist aus einer typischen Überexpression aus p16modA7 der Anteil des
überexprimierten Proteins His-ModA vom Gesamtproteingehalt bestimmt worden. Die
densitometrische Auswertung dieser Gelspur mit dem Programm Tina2.09 ergab einen
Anteil des rekombinanten Proteins von ca. 40 % der Gesamtproteinmenge.
1
2
3
4
5
6
68 kDa
25 kDa
14,4 kDa
Abb. 3.13
Überexpression aus p16modA7-R72K in BLR(DE3) pLysS und Isolation der
Einschlußkörper. Spur 1: Größenstandard (RSA, 68 kDa; α-Chymotrypsin,
25 kDa; Lysozym, 14,4 kDa); Spur 2: Gesamtzellextrakt; Spur 3: lösliche
Proteine; Spur 4: Sediment; Spur 5: Überstand nach waschen der
Einschlußkörper; Spur 6: gereinigte Einschlußkörper.
55
Ergebnisse
Abb. 3.14: Überexpression von His-ModA und densitometrisches Profil über die Gelspur.
Da die rekombinanten „His-Tag“-Proteine als Einschlußkörper exprimiert wurden, fand die
Reinigung der Proteine unter denaturierenden Bedingungen statt (2.7.3.1, 3.6).
3.5.2 Überexpression aus dem Vektor pBAD
Die Expressionsversuche von ModA aus dem Vektor pBAD erfolgten nach Angaben des
Herstellers mit L-Arabinose wie unter 2.5.3.4 beschrieben. Selbst bei 0,2 % Arabinose
Endkonzentration kam es aber zu keiner erkennbaren Expression des Zielproteins, obwohl
der Promotor bereits mit 0,004 % Arabinose (Angabe des Herstellers) induziert werden
kann. Die gleichen Ergebnisse lieferten die Expressionen der Mutanten ModA-R72K (aus
pBADmodA2-R72K) und ModA-E165D (aus pBADmodA2-E165D). An Hand einer
Wuchskurve (Abb. 3.15) zeigte sich, daß ModA bei einer Arabinosekonzentration von 0,2
% wahrscheinlich exprimiert wurde, wenn auch in sehr geringen Mengen, da hier ein
deutlicher Wuchsnachteil bei pBADmodA2 in LMG194 gegenüber dem induzierten
pBAD/HisB in LMG194 zu verzeichnen ist.
56
Ergebnisse
1,8
1,6
1,4
OD590
1,2
pBAD/HisB 0%
pBAD/HisB 0,2 %
pBADmodA2 0 %
pBADmodA2 0,2 %
1
0,8
0,6
0,4
0,2
0
0
1
2
3
4
5
6
7
8
9
Stunden
Abb. 3.15
Wuchskurven von LMG194 mit den Vektoren pBAD/HisB und pBADmodA2 unter nicht
induzierten und induzierten (0,2 % Arabinose) Bedingungen. Die %-Angaben in der
Legende beziehen sich auf die Arabinosekonzentration.
3.6 Reinigung von ModA unter denaturierenden Bedingungen
Die rekombinanten Proteine His-ModA und His-ModB aus den Vektoren p16modA7 bzw.
p16modB1 wurden als Einschlußkörper exprimiert (Abb. 3.13) und lagen somit als
inaktive Formen dieser Proteine vor. Diese Einschlußkörper wurden wie unter 2.5.5
beschrieben isoliert und im Aufschlußpuffer mit 6 M GuHCl aufgelöst. Aus einer 500 ml
Überexpressionskultur erhielt man, je nachdem wie gut die Expression war, ca. 80 – 250
mg isolierte Einschlußkörper.
Die denaturierten Proteine wurden anschließend an eine Ni-NTA Säulenmatrix gebunden
und durch schrittweise Verringerung des denaturierenden Agenz im Aufschlußpuffer auf
der Säule renaturiert (2.7.3.1). Die Elution der Proteine erfolgte mit einem Imidazol
Stufengradienten, wobei die Proteine bei einer Imidazolkonzentration von 250 mM von der
Säule eluierten.
Bei diesem Verfahren stellte sich allerdings heraus, daß die denaturierten „His-Tag“Proteine nur sehr schlecht an dem Ni-NTA Säulenmaterial banden. Pro Säulenlauf ließen
sich nur 0,8 bis 1,6 mg Protein, statt den zu erwarteten 50 mg von einer 5 ml Säule,
isolieren. Ein Ausweichen auf alternative Säulenmaterialien wie Talon (Clontech) oder
His•Bind (Novagen) brachte ebenfalls keine Verbesserung der Bindung.
57
Ergebnisse
Das Trx-ModA Fusionsprotein band unter denaturierenden Bedingungen viel besser an der
Ni-NTA Matrix als His-ModA unter gleichen Bedingungen. Das Trx-ModA hat außer dem
C-terminalen „His-Tag“ am ModA noch einen internen „His-Tag“ zwischen dem Trx und
ModA. Zum Vergleich des Aufbaus beider Proteine siehe Tabelle 3.2. Es wurde nun
vermutet, daß der C-terminale „His-Tag“ für die bessere Bindung am Säulenmaterial
verantwortlich ist. Da das Thioredoxin, wie sich noch zeigen wird, keinen Einfluß auf die
Löslichkeit von ModA hat, sollte dieses aus dem Vektor entfernt werden und das
rekombinante Protein ModA-His exprimiert werden (3.12).
Tabelle 3.2:
Aufbau der Proteine His-ModA und Trx-ModA.
His-ModA
10 Histidine – ModA
Trx-ModA
Trx – 6 Histidine – ModA – 6 Histidine
3.7 Nachweis des „His-Tags“
Zunächst wurde vermutet, daß die exprimierten Proteine ihren „His-Tag“ evtl. verloren
hatten und somit nicht mehr am Säulenmaterial binden konnten. Dies sollte durch eine
Western Blot Analyse nachgeprüft werden (2.7.6). Dazu wurde ein Ni-NTA HRP Konjugat
(Qiagen) verwendet. Der Nachweis erfolgte über Chemilumineszenz (ECL von
Amersham). In Abb. 3.16 sieht man den deutlichen Nachweis des „His-Tags“ am
rekombinanten Protein His-ModA. Obwohl das verwendete Ni-NTA Konjugat das
Vorhandensein des „His-Tags“ eindeutig belegen konnte, blieb nur sehr wenig von dem
Protein an der entsprechenden Ni-NTA Matrix der Säulen haften. Der Blot zeigt aber auch,
daß nur ein kaum detektierbarer Anteil des Fusionsproteins sich in der löslichen Fraktion
befindet. Dieser Anteil war zu gering, um das native Protein in größeren Mengen aus der
löslichen Proteinfraktion zu reinigen.
Das Problem mit den denaturierten Proteinen, die nicht an dem Säulenmaterial haften
bleiben ist bekannt (Steinert, Forschungsabteilung Qiagen, persönliche Mitteilung). Es sind
zwei andere Proteine bekannt, die unter denaturierenden Bedingungen nicht an der NiNTA Matrix binden. Diese Proteine binden aber unter nativen Bedingungen an dem
Säulenmaterial und können so gereinigt werden. Eine Erklärung für dieses Phänomen
konnte nicht gegeben werden, da unter denaturierenden Bedingungen der „His-Tag“ frei
zugänglich und die Bindung an die Matrix ohne Einschränkungen möglich sein sollte.
So wurde im Folgenden versucht die Expressionsbedingungen der Art zu gestalten, daß
zumindest ein Teil der exprimierten Proteine in löslicher Form vorliegt.
58
Ergebnisse
M
1
2
3
4
5
1
2
3
4
5
50 kDa
30 kDa
20 kDa
Abb. 3.16
Western Blot zum Nachweis des „His-Tags“ an dem rekombinanten Protein HisModA. PVDF-Membran, mit Coomassie gefärbt (links) und dazugehöriger Film
(rechts). Spur 1: BLR(DE3) pLysS (negativ Kontrolle); Spur 2: Gesamtzellextrakt
nach Überexpression von His-ModA; Spur 3: lösliche Proteine nach der
Überexpression; Spur 4: Überstand der gewaschenen Einschlußkörper; Spur 5:
isolierte Einschlußkörper.
3.8 Versuche zur Vermeidung von Einschlußkörpern
Es gibt verschiedene Methoden die Bildung von Einschlußkörpern zu verhindern. C.H.
SCHEIN (1991) hat sechs verschiedene Wege aufgelistet, über die man die Proteinfaltung
während
der
Überexpression
verbessern
kann.
Als
erstes
sollte
man
die
Wuchsbedingungen verändern, dann die Fusion zu einem Solubilisierungslinker herstellen
oder das Protein ausschleusen. Des weiteren könnte man Chaperone oder Foldasen
coexprimieren und man sollte „klebrige Proteinsequenzen“, also solche mit einer hohen
Adhäsion (z.B. L-R-E, R-G-D-(V, S oder T) ), vermeiden. Zum Schluß könnten auch noch
Mutationen in die Primärstruktur der Proteinsequenz eingebracht werden, hier sind die
Methoden der Vorhersage jedoch noch nicht ausgereift.
Im Folgenden wurden einige dieser Wege beschritten.
3.8.1 Veränderungen der Expressionsbedingungen
Die Anzuchtbedingungen zu verändern schien erst einmal das einfachste Mittel zu sein die
Bildung der Einschlußkörper zu verhindern. Dazu wurden die unter 2.5.1 beschriebenen
Nährmedien bei Temperaturen von 16° C, 20° C, 30° C, 37° C und 45° C für die
Überexpression verwendet. Außerdem wurde die Induktion der Expression mit 0,5 mM,
0,75 mM und 1 mM IPTG durchgeführt. Die Expression der Proteine fand im Stamm
C41(DE3) statt.
59
Ergebnisse
Den größten Erfolg zum löslichen Protein zu kommen versprach dabei das TryptonPhosphat-Medium. MOORE et al. (1993) verwendeten dieses Medium, um die dCMP
Deaminase des T4 von einem pET-Vektor aus in löslicher Form zu exprimieren, wobei
Versuche mit anderen Medien nur zur Bildung von Einschlußkörpern geführt hatten.
Im Falle der Proteine ModA und ModB ließ sich jedoch in keinem Versuchsansatz der
Anteil an löslichem Protein steigern. Es mußte also ein anderer Weg gewählt werden.
3.8.2 Überexpression in Gegenwart des Bakteriocinfreisetzungsproteins
Die Expression des Bakteriocinfreisetzungsproteins (BRP) initiiert die Freisetzung
periplasmatischer
und
cytosolischer
E.
coli
Proteine
in
das
Kulturmedium.
Überexprimierte Proteine sollten somit nicht im Cytoplasma akkumulieren und als
Einschlußkörper aggregieren können.
Für die Versuche wurde das Plasmid pSW1 mit p16modA7 in BLR(DE3) cotransformiert
und wie unter 2.5.3.5 beschrieben angezogen. Es wurden Gesamtzellextrakte nach erfolgter
Überexpression bei verschiedenen Gaben von Mitomycin C mit den Gelen der zugehörigen
Kulturüberstände verglichen. Bei der Auswertung der SDS-Polyacrylamidgele zeigte sich,
daß bei einer Konzentration von 50 ng/ml Mitomycin C E. coli Proteine aus den Bakterien
in das Medium ausgeschleust wurden. Obwohl in den Gesamtzellextrakten eine deutliche
Überexpression zu verzeichnen war, fand sich im Überstand kein ausgeschleustes HisModA wieder.
3.8.3 Ausschleusen der exprimierten Proteine in den periplasmatischen Raum
Mit dem Vektor pET-22b(+) ist es möglich, die zu exprimierenden Proteine mit einer
Leitsequenz („pelB-Leader“) für den periplasmatischen Raum zu versehen und die
Proteine dorthin zu transportieren. Dies wurde mit ModB ausprobiert, das aus dem Vektor
p22modBB2 exprimiert wurde. Da sich auch hier wieder nur die Bildung von
Einschlußkörpern nachweisen ließ, wurde auf eine Klonierung von modA in diesem Vektor
verzichtet.
60
Ergebnisse
3.8.4 Coexpression von Chaperonen
Einige Proteine benötigen sogenannte Chaperone, die sie bei der Faltung zur aktiven Form
unterstützen oder es erst ermöglichen die aktive Form einzunehmen. Damit bei einer
Überexpression die vorhandenen Chaperone nicht austitriert werden, kann man diese
coexprimieren und die „Faltungshelfer“ somit in ausreichender Menge zur Verfügung
stellen. Zum Einsatz kamen die Chaperone GroES/GroEL und DnaK. Bei der
Coexpression von GroES/GroEL mit His-ModA bzw. Trx-ModA (2.5.3.6) zeigte sich, daß
die Chaperone sehr gut überexprimiert wurden, die Expression von His-ModA bzw. TrxModA aber nicht zu erkennen war. Die Coexpression mit DnaK und His-ModA lieferte
von beiden Proteinen eine gute Überexpression, wobei von DnaK ca. die Hälfte löslich und
die andere Hälfte als unlösliches Protein vorlag. His-ModA fand sich nur in der
unlöslichen Proteinfraktion wieder.
3.8.5 Fusion von ModA mit Thioredoxin
Thioredoxin (109 Aminosäuren, 11.675 Da) ist ein Protein, was noch bei einer
Konzentration von 40 % des gesamten Zellproteins in Lösung vorliegen kann. Deshalb
erschien es geeignet die Bildung der Einschlußkörper zumindest teilweise zu unterbinden.
Wie unter 3.2.4 bereits beschrieben wurde das Gen modA in den Vektor pET-32b(+)
kloniert. Bei der Überexpression des Fusionsproteins zeigte sich aber, daß die
Aggregationsfähigkeit von ModA die Fähigkeit der Löslichkeit des Thioredoxins
überschreitet und man kein lösliches Fusionsprotein vorfand.
3.9 Renaturierung von Einschlußkörpern
Da es nicht möglich war, durch die Anzuchtbedingungen während der Expression einen
größeren Teil der rekombinanten Proteine in Lösung zu halten, sollten Bedingungen
gefunden werden, unter denen sich die denaturierten Proteine in ihre aktive Form
zurückführen ließen.
3.9.1 Renaturierung durch Verdünnung
Es wurden, wie unter 2.7.4.1 beschrieben, die in 7 M GuHCl aufgelösten Einschlußkörper
langsam unter ständigem Rühren in einem Renaturierungspuffer getropft. Dabei sollte
anfangs die Konzentration der Proteine so gering sein, daß sie sich während ihres
Faltungsprozesses nicht gegenseitig behindern und sie sich somit ungestört in ihre aktive
61
Ergebnisse
Form falten lassen. Nach Zentrifugation und Einengung der löslichen Fraktion über
Zentrifugationsfiltration fand sich kein nennenswerter Anteil der Proteine in Lösung
wieder, fast 100 % der eingesetzten Proteine wurden wieder sedimentiert.
3.9.2 Renaturierung durch Dialyse
Wurden die in GuHCl gelösten Einschlußkörper stufenweise gegen einen DialyseRenaturierungs-Puffer dialysiert (2.7.4.2), flockten die Proteine bei weniger als 2 M
Harnstoff im Puffer aus.
Wurden die Einschlußkörper bei einem pH von 12,0 denaturiert (2.5.5) und durch Dialyse
der pH Wert auf 8 gebracht (2.7.4.2) hatte man kaum Verluste durch ausgefallene Proteine
während der Dialyse. Bei Proteinkonzentrationen < 1 mg/ml für ModA oder His-ModA
konnten fast 100 % der Proteine in Lösung gehalten werden. Für das Trx-ModA
Fusionsprotein liegt diese Konzentration bei < 3 mg/ml. Bei höheren Konzentrationen
neigen die Proteine auch hier wieder dazu ein Präzipitat zu bilden.
Mit dieser letzten Methode hatte man nun die Möglichkeit größere Mengen der
rekombinanten Proteine in eine lösliche Form zu überführen.
3.10 Reinigung von ModA unter nativen Bedingungen
Da nun größere Mengen löslicher rekombinanter Proteine zur Verfügung standen, wurde
die Reinigung von His-ModA unter nativen Bedingungen wiederholt (2.7.3.1). Das NiNTA Säulenmaterial wurde nach Angabe des Herstellers (Qiagen) mit den entsprechenden
Puffern verwendet. Unter nativen Bedingungen banden die „His-Tag“-Proteine viel besser
an der Säule als unter denaturierenden Bedingungen. Ein Teil der Proteine eluierte jedoch
bereits bei einer Konzentration von 100 mM Imidazol von der Säule, der größte Teil
jedoch erst bei 250 mM Imidazol. Die Fraktionen mit dem gewünschten Protein wurden
vereinigt und gegen Dialyse-Puffer 2 (2.7.3.1) dialysiert. Die Reinheit der Proteine wurde
densitometrisch
mit
dem
Programm
Tina2.09
über
ein
silbergefärbtes
SDS-
Polyacrylamidgel bestimmt (Abb. 3.17). Nach einer solchen Auswertung ist das Protein zu
ca. 95 % sauber.
62
Ergebnisse
Abb. 3.17: Analyse zur Reinheit durch densitometrische Auswertung eines silbergefärbten 13
%igen SDS-Polyacrylamidgels. In der Spur wurden 3 µg gereinigtes His-ModA
aufgetragen. Als Marker diente eine 10 kDa-Leiter.
3.11 Nachweis katalytisch aktiver Aminosäuren durch ortsgerichtete
Mutagenese
Nach dem strukturellen Alignment von BAZAN & KOCH-NOLTE (1997) (Abb. 1.9) wurden
vier katalytisch essentielle Aminosäuren für die Proteine ModA und ModB vorhergesagt.
Für ModA sind dies die Aminosäuren Arginin 72, Serin 109, Phenylalanin 129 und
Glutamat 165 (Abb. 3.18). Für ModB wurden die Aminosäuren Arginin 73, Serin 111,
Tyrosin 131 und Glutamat 173 postuliert (Abb. 3.18). Durch den Austausch der
Aminosäuren Arg72 bzw. Glu165 für ModA und Arg73 bzw. Glu173 für ModB sollten
Mutanten generiert werden, deren ADP-Ribosylierungs-Aktivität stark eingeschränkt sein
sollte. Die Mutagenese erfolgte mit dem „QuikChange Site-Directed Mutagenesis Kit“
von Stratagene (2.6.4). Es wurden jeweils nur homologe Aminosäuren ausgetauscht, also
Arginin gegen Lysin und Glutamat gegen Aspartat. Nach erfolgter Mutagenese erhielt man
die Klone p16modA7-R72K, p16modA7-E165D, p16modB1-R73K und p16modB1E173D. Diese Mutanten wurden einem Plattentest zur Überprüfung ihrer Toxizität
unterzogen (2.5.4.3). Dabei stellte sich heraus, daß die Bakterien (C41(DE3)) mit den
mutierten Plasmiden unter induzierten Bedingungen auf den Agar-Platten wuchsen,
wohingegen Bakterien mit den Originalplasmiden kein Wachstum zeigten. Die Größe der
63
Ergebnisse
Kolonien unter induzierten und nicht induzierten Bedingungen kann hier als Maß der
Toxizität dienen. In einer Kooperation mit der Gruppe um Rimas Nivinskas (Litauen)
wurden weitere Mutanten hergestellt, eine Auflistung findet sich in Tabelle 3.3.
Dieser Test funktioniert nur in dem Stamm C41(DE3). Der Stamm C43(DE3), einer
anderen BL21(DE3) Mutante, zeigte mit den Originalplasmiden unter induzierten
Bedingungen ein Wachstum, wenn auch die Kolonien sehr klein blieben. In den Stämmen
BL21(DE3) oder BLR(DE3) findet man unter induzierten Bedingungen kein Wachstum
auf den Agar-Platten, egal ob die exprimierten Proteine eine toxische Wirkung haben oder
nicht.
Tabelle 3.3
Auflistung der in dieser Arbeit hergestellten Mutanten (fett) und der in der
Arbeitsgruppe von Rimas Nivinskas erzeugten Mutanten. Der Grad der
Toxizität kann an Hand der Koloniegröße im Vergleich zum Wuchs unter
induzierten und nicht induzierten Bedingungen ermittelt werden.
Mutation
Koloniegröße
(% von nicht induziert)
ModA
R72K
E165D
R72A
S109A
F127A
F129A
E163A
E165A
N128A
Q116A
Q164A
ModB
R73K
E173D
50
50
100
70-80
20
10
5
50
50
Mit diesem Plattentest konnte nachgewiesen werden, daß die Aminosäuren Arg72 und
Glu165 bei ModA und Arg73 und Glu173 bei ModB essentiell für die Aktivität der Proteine
sind. Selbst ein homologer Austausch dieser Aminosäuren senkte die Aktivität der Proteine
dermaßen, daß die Bakterien unter induzierten Bedingungen noch Kolonien von 50 % der
Größe wie unter nicht induzierten Bedingungen hervorbrachten. Wurden bei ModA die
Aminosäuren Arg72 bzw. Glu165 gegen Alanin ausgetauscht, ergab sich für R72A kein
Unterschied mehr in der Koloniegröße zwischen induziert und nicht induziert, für E165A
lag sie bei 70-80 %, also auch höher als bei dem konservativen Austausch E165D.
64
Ergebnisse
1
1
ATG ATT ATT AAT CTT GCA GAT GTT GAA CAG TTA TCT ATA AAA GCT GAA
M
I
I
N
L
A
D
V
E
Q
L
S
I
K
A
E
49
17
AGC GTT GAT TTT CAA TAT GAT ATG TAT AAA AAG GTC TGT GAA AAA TTT
S
V
D
F
Q
Y
D
M
Y
K
K
V
C
E
K
F
97
33
ACT GAC TTT GAG CAG TCT GTT CTT TGG CAA TGT ATG GAA GCC AAA AAG
T
D
F
E
Q
S
V
L
W
Q
C
M
E
A
K
K
145
49
AAT GAA GCT CTT CAT AAG CAT TTA AAT GAA ATC ATT AAA AAG CAT TTA
N
E
A
L
H
K
H
L
N
E
I
I
K
K
H
L
193
65
ACT AAA TCG CCT TAT CAA TTA TAT CGT GGT ATA TCA AAA TCG ACA AAA
T
K
S
P
Y
Q
L
Y
R
G
I
S
K
S
T
K
241
81
GAA CTC ATT AAA GAT TTA CAA GTT GGA GAA GTG TTT TCA ACG AAC AGG
E
L
I
K
D
L
Q
V
G
E
V
F
S
T
N
R
289
97
GTA GAT TCA TTT ACT ACT AGT TTG CAT ACA GCG TGT TCT TTT TCT TAT
V
D
S
F
T
T
S
L
H
T
A
C
S
F
S
Y
337
113
GCT GAA TAT TTC ACT GAA ACA ATA CTT CGT TTA AAA ACT GAT AAA GCT
A
E
Y
F
T
E
T
I
L
R
L
K
T
D
K
A
385
129
TTT AAT TAT TCT GAC CAT ATC AGC GAT ATT ATA CTT TCT TCT CCT AAT
F
N
Y
S
D
H
I
S
D
I
I
L
S
S
P
N
433
145
ACT GAG TTT AAG TAC ACG TAT GAA GAT ACT GAT GGA TTA GAT TCA GAG
T
E
F
K
Y
T
Y
E
D
T
D
G
L
D
S
E
481
161
CGT ACT GAT AAC TTA ATG ATG ATT GTG CGT GAA CAA GAA TGG ATG ATT
R
T
D
N
L
M
M
I
V
R
E
Q
E
W
M
I
529
177
CCA ATT GGA AAG TAT AAA ATA ACT TCT ATT TCA AAA GAA AAA TTA CAC
P
I
G
K
Y
K
I
T
S
I
S
K
E
K
L
H
577
193
GAT TCA TTT GGA ACA TTT AAA GTT TAT GAT ATT GAG GTA GTT GAA TG(A)
D
S
F
G
T
F
K
V
Y
D
I
E
V
V
E
-
1
Abb. 3.18
M o dB
M o dA
M
624
2
AAA TAC TCA GTA ATG CAA CTA AAA GAT TTT AAA ATA AAA TCA ATG GAT
K
Y
S
V
M
Q
L
K
D
F
K
I
K
S
M
D
672
18
GCA TCG GTG CGT GCT TCT ATT CGT GAA GAA TTA CTT TCT GAA GGG TTT
A
S
V
R
A
S
I
R
E
E
L
L
S
E
G
F
720
34
768
50
AAT TTA TCT GAA ATT GAA CTT TTA ATT CAT TGT ATT ACT AAT AAA CCA
N
L
S
E
I
E
L
L
I
H
C
I
T
N
K
P
GAT GAC CAT TCT TGG TTA AAT GAA ATA ATC AAA TCT CGT TTG GTT CCA
D
D
H
S
W
L
N
E
I
I
K
S
R
L
V
P
816
66
864
82
AAC GAT AAA CCT CTT TGG AGA GGT GTT CCA GCT GAG ACT AAA CAA GTA
N
D
K
P
L
W
R
G
V
P
A
E
T
K
Q
V
TTA AAT CAA GGA ATT GAT ATT ATT ACA TTT GAT AAA GTC GTA TCA GCT
L
N
Q
G
I
D
I
I
T
F
D
K
V
V
S
A
912
98
TCA TAT GAT AAA AAT ATA GCT CTA CAT TTT GCT TCT GGT TTA GAG TAT
S
Y
D
K
N
I
A
L
H
F
A
S
G
L
E
Y
960
114
AAC ACA CAA GTT ATT TTT GAA TTC AAA GCT CCT ATG GTA TTC AAT TTC
N
T
Q
V
I
F
E
F
K
A
P
M
V
F
N
F
1008
130
CAG GAG TAT GCT ATA AAA GCT CTA CGC TGT AAA GAA TAC AAT CCA AAC
Q
E
Y
A
I
K
A
L
R
C
K
E
Y
N
P
N
1056
146
TTT AAG TTT CCG GAT AGT CAT CGT TAT CGT AAT ATG GAA TTA GTT TCA
F
K
F
P
D
S
H
R
Y
R
N
M
E
L
V
S
1104
162
1152
178
GAT GAA CAA GAA GTA ATG ATA CCA GCT GGA AGT GTA TTT AGA ATT GCA
D
E
Q
E
V
M
I
P
A
G
S
V
F
R
I
A
GAT AGA TAT GAG TAT AAA AAG TGT TCA ACA TAC ACT ATC TAT ACT CTT
D
R
Y
E
Y
K
K
C
S
T
Y
T
I
Y
T
L
1200
194
GAT TTT GAA GGA TTT AAT CTA TAA TGG AAG GAC TTA GAT TCA TTA TAC
D
F
E
G
F
N
L
W
K
D
L
D
S
L
Y
DNA-Sequenz und abgeleitete Aminosäuresequenz der Gene modB und modA. Die
Start-Codons sind fett und unterstrichen dargestellt. Die als katalytisch aktiv
postulierten Aminosäuren sind durch ein Fünfeck markiert. Das (A) in der Sequenz
an Position 624 wurde in die nächste Zeile transferiert, um in den neuen
Leserahmen für ModA zu gelangen.
65
Ergebnisse
3.12 Entfernung des Trx aus p32modA2
Das rekombinante Fusionsprotein Trx-ModA zeigte unter denaturierenden Bedingungen
ein sehr viel besseres Bindeverhalten an der Ni-NTA Matrix als His-ModA. Diese
verbesserte Bindung wurde auf den C-terminalen „His-Tag“ zurückgeführt. Da das Trx
keine Wirkung auf die Löslichkeit von ModA hatte, sollte das Gen trxA aus dem Vektor
entfernt werden, um es nach der erfolgten Reinigung nicht durch eine Protease abspalten
zu müssen.
Das Gen trxA sollte aus dem Plasmid p32modA2 über die Schnittstellen NdeI und NcoI
entfernt werden. Da im Gen modA aber eine interne NdeI Schnittstelle vorhanden ist,
wurde diese durch eine ortsspezifische Mutagenese (2.6.4) mit den Primern Mut-A-Nde1
und Mut-A-Nde2 (2.4.2) eliminiert, ohne die Aminosäuresequenz zu verändern. Das so
erzeugte Plasmid p32trx-modA-NdeI wurde dann für die Deletion von trxA eingesetzt.
Dazu wurde das Plasmid mit NdeI und NcoI restringiert, die überhängenden Enden unter
Zuhilfenahme des Klenow-Fragments aufgefüllt und der Vektor ligiert. Nach erfolgter
Transformation wurden einige Transformanden mittels einer Restriktionsanalyse mit RsaI
oder PvuII auf das verkürzte Plasmid hin untersucht.
Überexpressionsversuche mit diesen so verkürzten Plasmiden zeigten aber keine
Expression des Proteins ModA-His. Nach Deletion des trxA Gens fanden sich zwischen
der Shine-Dalgarno Region (SD-Region) und dem Start-Codon ATG 10 Nukleotide, vor
der Deletion befanden sich dort nur 8 Nukleotide. Nach CHEN et al. (1994) spielt der
Abstand zwischen der Ribosomenbindestelle und dem Start-Codon aber eine wichtige
Rolle für eine effiziente Translation. Deshalb wurde im zweiten Ansatz das Gen trxA wie
in Abb. 3.19 dargestellt eliminiert. Nach dieser Vorgehensweise sollte man wieder einen
Spacer von 8 Nukleotiden erhalten. Von diesem Plasmid ließ sich eine gute
Überexpression von ModA-His induzieren.
66
Ergebnisse
Xho I
Pvu II
Eco RI
Nde I del
Pvu II
Nco I
T7 Ter
Nde I
modA-His
amp
Nde I
trx-His
T7 Pro
p32 trx-modA-NdeI
NdeI +
S1-Nuklease
6445 bps
Nco I
ori
lacI
Xho I
Pvu II
Eco RI
Pvu II
T7 Ter
modA-His
amp
'trx-His
Pvu II
Pvu II
T7 Pro
Pvu II
Fragment 1
6098 bps
lacI
Xho I
Pvu II
Eco RI
Pvu II
ori
NcoI +
Klenow Auffüllung
Pvu II
Pvu II
T7 Ter
modA-His
Pvu II
amp
T7 Pro
Fragment 2
Xho I
Pvu II
Eco RI
Pvu II
5968 bps
lacI
T7 Ter
modA-His
ori
Ligation
T7 Pro
amp
Pvu II
Pvu II
Pvu II
p32 modA-His
5968 bps
lacI
ori
Pvu II
Pvu II
Pvu II
Abb. 3.19
Deletion von trxA aus dem Vektor p32trx-modA-NdeI. Die deletierte NdeI
Schnittstelle im Gen modA ist in Magenta hervorgehoben, die verwendeten
Schnittstellen NdeI und NcoI sind in Rot dargestellt.
Wie sich bei einer späteren Sequenzierung herausstellte sind in dem Plasmid
p32modA-His 12 bp zusätzlich deletiert (Abb. 3.20), so daß die Translation von dem
zweiten ATG stattfand und das Protein um die ersten fünf Aminosäuren verkürzt vorlag.
Hier fand eine gute Translation trotz eines Spacers von 11 Nukleotiden zwischen der SDRegion und dem AUG statt.
erwartete Sequenz
aagaaggagatatacac atg gaa tac tca gta atg caa cta
M
E
Y
S
V
M
Q
L
gefundene Sequenz aagaaggaga....... ... ..a tac tca gta atg caa cta
M
Q
L
Abb. 3.20 Zusätzliche Deletion im Vektor p32modA-His. Die Ribosomenbindestelle und das StartCodon sind jeweils Fett dargestellt.
Die erwartete bessere Bindung von ModA-His an der Ni-NTA Matrix unter
denaturierenden Bedingungen konnte allerdings nicht bestätigt werden. So muß die
verbesserte Bindefähigkeit des Trx-ModA Fusionsproteins auf die Anwesenheit beider
„His-Tags“ zurückzuführen sein (Tabelle 3.2).
67
Ergebnisse
3.13 ADP-Ribosylierung durch ModA und ModB
Die ADP-Ribosylierung wurde nach der Methode von ROHRER et al. (1975) (2.8.1) mit
32
P-NAD+ durchgeführt. Die löslichen E. coli Proteine wurden in einem 13 %igen SDS-
Polyacrylamidgel aufgetrennt und ein Autoradiogramm des gefärbten und getrockneten
Gels angefertigt. Von Alt (von H. Koch zur Verfügung gestellt) und ModA konnte
gereinigtes Protein eingesetzt werden, für ModB wurden die löslichen Proteine einer
Kultur eingesetzt, die ModB überexprimiert hatte.
Abb. 3.21 zeigt die unterschiedlichen Ribosylierungsmuster der drei T4 ADPRibosyltransferasen Alt, ModA und ModB. Man erkennt, daß sich alle drei Muster
unterscheiden. In einigen Bereichen findet man Signale auf gleicher Höhe (Abb. 3.21,
Tabelle 3.4). Die Kontrolle weist ebenfalls eine markierte Bande bei ca. 70 kDa auf, was
auf eine E. coli eigene ADP-Ribosyltransferase hindeutet. Von ModA war bekannt, daß es
die α-Untereinheit der E. coli RNA-Polymerase markiert. Diese Markierung findet sich im
Gel bei einer Größe von ca. 42 kDa wieder. Außerdem vollzieht ModA eine
Autoribosylierung (Bande bei ca. 28 kDa). Die anderen markierten Proteine werden im
Moment identifiziert.
Im Rahmen seiner Diplomarbeit fand R. DEPPING (1998), daß es sich bei der durch ModB
stark markierten Bande bei ca. 70 kDa um das S1-Protein der kleinen Untereinheit der
Ribosomen handelt. Auch hier findet die Identifizierung der anderen markierten Proteine
zur Zeit statt.
Vergleichende Tests mit den unveränderten Proteinen ModA bzw. ModB aus p11modAB3
bzw. p11modBB5 und den „His-Tag“ Proteinen His-ModA und His-ModB oder dem
Fusionsprotein Trx-ModA ergaben immer identische Ribosylierungsmuster für ModA
bzw. ModB. Dies deutet darauf hin, daß der „His-Tag“ und das Thioredoxin keinen
Einfluß auf die Erkennung der Zielproteine haben und die Transferasen immer noch aktiv
sind.
Die beiden Mutanten ModA-R72K und ModA-E165D zeigten in diesem Test nur wenige
sehr schwache Banden auf dem Röntgenfilm, was auf eine niedrigere Restaktivität der
beiden Proteine schließen läßt (siehe auch 3.11).
68
Ergebnisse
Abb. 3.21
Tabelle 3.4
Ribosylierungsmuster von löslichen E. coli Proteinen in Gegenwart von Alt, ModA oder
ModB. A: 13% SDS-Polyacrylamidgel mit Coomassie Brillantblau gefärbt. B:
Autoradiogramm von A. Die Expositionsdauer für Alt betrug 4 Tage, die der anderen
Spuren 9 Tage. Die starke Markierung auf der Höhe der S1-Untereinheit in der Alt Spur
stammt von der Autoribosylierung von Alt. Ob das S1 Protein auch von Alt ribosyliert
wird, wird zur Zeit noch untersucht.
Molekulargewichte der durch ModA oder ModB markierten Proteinbanden. Wenn
bekannt, wurden die entsprechenden Proteine in Klammern angegeben.
ModA
79 kDa
56 kDa
50 kDa
42 kDa
(α–Untereinheit)
35 kDa
28 kDa
(Autoribosylierung ModA)
22 kDa
14 kDa
ModB
72 kDa
(S1-Untereinheit)
50 kDa
46 kDa
42 kDa
36 kDa
29 kDa
28 kDa
27 kDa
22 kDa
21 kDa
14 kDa
Es wurde ebenfalls untersucht, ob es im Zusammenspiel der drei ADP-Ribosyltransferasen
zu synergetischen Effekten kommt. Dazu wurden die Ribosylierungsmuster der einzelnen
Transferasen mit den Mustern verglichen, die entstehen wenn mehr als eine Transferase im
Reaktionsansatz tätig ist. In Abb. 3.22 ist das Ergebnis dieses Versuchs wiedergegeben.
69
Ergebnisse
Man erkennt, daß sich die Bandenmuster lediglich aufaddieren, und es zu keiner neuen
Markierung kommt. Daraus folgt, daß alle drei ADP-Ribosyltransferasen unabhängig
voneinander agieren und keine auf die Anwesenheit der anderen angewiesen ist.
Abb. 3.22
Vergleich der Ribosylierungsmuster von Alt, ModA und ModB sowie die Muster nach
Einsatz von Kombinationen dieser Proteine. A: 13% SDS-Polyacrylamidgel
Coomassie Brillantblau gefärbt. B: Autoradiogramm von A. Als Marker wurde eine
10 kDa Leiter verwendet, außerdem sind die Positionen der Untereinheiten der E. coli
RNA-Polymerase angegeben.
3.14 Bestimmung der ADP-Ribosyltransferase Aktivität von ModA
3.14.1 Herstellung von p-Nitrobenzylidin-aminoguanidin
Über einen photometrischen Test sollten die Werte für die Michaelis Konstante (KM) und
die Reaktionsgeschwindigkeit (Vmax) ermittelt werden. Für diesen Test mußte zunächst das
Substrat p-Nitrobenzylidin-aminoguanidin (NBAG) synthetisiert werden (2.8.2.1). Zur
Überprüfung des Substrates wurde ein Absorptionsspektrum aufgenommen (Abb. 3.23). Es
fanden sich die bei SOMAN et al. (1983) angegebenen Absorptionsmaxima bei 315 nm in
0,1 N HCl und 375 nm in 0,1 N NaOH.
70
Ergebnisse
Abb. 3.23
λ-Scan von NBAG im Bereich zwischen 230 nm bis 550 nm.
NBAG in 0,1 N NaOH
NBAG in Tris-Acetat pH 7,4
NBAG in 0,1 N HCl
3.14.2 Bestimmung von KM und Vmax
Nachdem das NBAG für den photometrischen Aktivitätstest hergestellt war, wurde die
ADP-Ribosylierung des NBAG in Abhängigkeit zur Proteinkonzentration ermittelt. Es
ergab sich unter den gewählten Versuchsbedingungen (2.8.2) ein linearer Zusammenhang
zwischen der Absorptionsänderung und der ModA Konzentration (Abb. 3.24). Dies war
ein Hinweis darauf, daß es während des Versuchs zu keiner Limitierung der Substrate kam.
Im weiteren Verlauf zur Bestimmung von Vmax und KM wurde einmal die Konzentration an
NAD+ konstant gehalten und die Konzentration von NBAG variiert (Abb. 3.25, Abb. 3.26)
und entsprechend die Konzentration von NBAG konstant gehalten und die Konzentration
von NAD+ variiert (Abb. 3.27, Abb. 3.28). Die Absorptionsänderung wurde jeweils über
einen Zeitraum von einer Stunde ermittelt. Aus der Geradengleichung (y = mx +b) des
Lineweaver-Burk-Diagramms ergaben sich die Werte für Vmax = 1/b und KM = m/b. In
Tabelle
3.5
sind
die
ermittelten
Werte
zusammengefaßt.
Unter
diesen
Versuchsbedingungen ergab sich für die Abhängigkeit von NBAG ein Vmax-Wert von 5,34
mol Produkt . h-1 . mol ModA-1 und ein KM-Wert von 219 µM. Für die Abhängigkeit von
NAD+ ergaben sich für Vmax 20,04 mol Produkt . h-1 . mol ModA-1 und für KM 258 µM.
71
Ergebnisse
0,05
y = 0,0009x
2
R = 0,9955
0,045
∆ Absorption bei 370 nm
0,04
0,035
0,03
0,025
0,02
0,015
0,01
0,005
0
0
10
20
30
40
50
60
ModA (µg/ml)
Abb. 3.24
Effekt der Enzymkonzentration auf die Rate der ADP-Ribosylierung von NBAG. Die
Reaktion fand über einen Zeitraum von 60 min statt. Es sind die Geradengleichung
und das Bestimmtheitsmaß der Ausgleichsgeraden angegeben. (Endkonzentrationen:
10 mM NAD+; 32 mM DTE; 0,4 mM NBAG; 20 mM Tris-acetat pH 7,4)
V
(mol Produkt/(h * mol ModA))
3,5
3
2,5
2
1,5
1
0,5
0
0
0,05
0,1
0,15
0,2
0,25
0,3
0,35
0,4
0,45
[NBAG]
(mM)
Abb. 3.25
Darstellung der Reaktionsgeschwindigkeit V von ModA als Funktion der NBAG
Konzentration nach Michaelis-Menten.
72
Ergebnisse
1/V
(1/(mol Produkt/(h * mol ModA))
1,2
y = 0,0409x + 0,1872
2
R = 0,9986
1
0,8
0,6
0,4
0,2
0
-10
-5
0
5
10
15
20
25
1/[NBAG]
(1/mM)
Abb. 3.26
Doppeltreziproke Darstellung der Reaktionsgeschwindigkeit V von ModA als
Funktion der NBAG Konzentration nach Lineweaver-Burk. Außerdem sind die
Geradengleichung und das Bestimmtheitsmaß der Ausgleichsgeraden angegeben.
V
(mol Produkt/(h*mol ModA))
25
20
15
10
5
0
0
1
2
3
4
5
6
[NAD]
(mM)
Abb. 3.27
Darstellung der Reaktionsgeschwindigkeit V von ModA als Funktion der NAD+
Konzentration nach Michaelis-Menten.
73
Ergebnisse
0,18
y = 0,0129x + 0,0499
R2 = 0,9986
1/V
(1/mol Produkt/(h * mol ModA))
0,16
0,14
0,12
0,1
0,08
0,06
0,04
0,02
0
-6
-4
-2
0
2
4
6
8
10
1/[NAD]
(1/mM)
Abb. 3.28
Tabelle 3.5
Doppeltreziproke Darstellung der Reaktionsgeschwindigkeit V von ModA als
Funktion der NAD Konzentration nach Lineweaver-Burk. Außerdem sind die
Geradengleichung und das Bestimmtheitsmaß der Ausgleichsgeraden angegeben.
Vmax- und KM-Werte von ModA sowie kkat und die Spezifitätskonstante (kkat/KM)
für die Substrate NBAG und NAD.
Vmax
KM
kkat
kkat/KM
(mol Produkt . h-1 . mol ModA-1)
(µM)
(s-1)
(l . mol-1 . s-1)
5,34
20,04
219
258
0,00148
0,005567
7
22
NBAG
NAD
3.15 Transkriptionsversuche mit alterierter und modifizierter E. coli RNAPolymerase
WILKENS & RÜGER (1996) konnten zeigen, daß in einem in vivo System die Transkription
von vielen frühen T4 Promotoren durch Alt ADP-ribosylierte (alterierte) E. coli RNAPolymerase gesteigert werden kann. Nun sollte mit in vitro Versuchen die Auswirkung
durch ModA ADP-ribosylierter (modifizierter) RNA-Polymerase auf die Transkription
untersucht werden (2.9).
Die ersten Versuche mit gereinigter E. coli RNA-Polymerase, die mit Alt
(Positivkontrolle) bzw. ModA ribosyliert wurde, und T4 Wildtyp DNA erbrachte keine
eindeutigen Ergebnisse. Eine Steigerung der Transkriptionsrate durch Alt, wie es zu
erwarten gewesen wäre, konnte in diesem System nicht nachgewiesen werden. Eine
Transkriptionskinetik von T4 DNA bzw. ausgesuchten, klonierten frühen T4 Promotoren
(2.9.1) zeigte in diesem in vitro System ebenfalls keine eindeutige Änderung in der
Transkriptionsrate. Die Kinetik wurde über 60 min aufgenommen, wobei nach 10 min Alt
74
Ergebnisse
oder ModA dem Reaktionsansatz zugesetzt wurde und die Einbaurate an α32P-UTP mit
einer Kontrollreaktion ohne Alt oder ModA verglichen wurde.
Es schien in diesem System evtl. eine weitere unbekannte Komponente, wie ein
„Mittlerprotein“ zu fehlen. Wahrscheinlicher ist aber, daß aufgrund der geringen
Reaktionsgeschwindigkeiten von ModA bzw. Alt kein Effekt auf die Transkription
gefunden werden konnte (Tabelle 4.3). Deshalb wurden E. coli Kulturen mit den
Plasmiden pET-16b (Kontrolle), p16modA7 (ModA) und pTKRI (Alt) unter induzierten
Bedingungen bis zu einer OD590 von 0,65 angezogen und geerntet. Während des
Wachstums der Bakterien sollte die RNA-Polymerase in Gegenwart des Vektors pET-16b
unverändert, in Gegenwart des Vektors p16modA7 modifiziert und bei pTKRI alteriert
vorliegen. Für die folgenden Transkriptionsexperimente wurden die Zellen aufgeschlossen
und die lösliche Proteinfraktion in unterschiedlichen Mengen eingesetzt (2.9.2). Um die
Transkription von mitgeschleppter genomischer E. coli DNA in der löslichen
Proteinfraktion zu bestimmen, wurden Kontrollversuche ohne Zugabe zusätzlicher DNA
durchgeführt. Die Versuchsansätze wurden in Hinblick auf den Einbau der hier
gemessenen Radioaktivität rechnerisch korrigiert. Die Transkription wurde mit T4 Wildtyp
DNA und mit genomischer E. coli DNA durchgeführt und verglichen. In Abb. 3.29 sind
die Ergebnisse zusammengefaßt. Man sieht für die T4 DNA, daß die alterierte RNAPolymerase die Transkription bei Zugabe von mehr löslichem Protein steigert. Gibt man
mehr lösliches Protein von der Kontrolle (normale RNA-Polymerase) dazu, kann man
keine Änderung feststellen, bei einer noch höheren Proteinkonzentration findet man
schließlich eine geringere Transkription. Bei der modifizierten RNA-Polymerase findet
man von Anfang an bereits eine nur geringe Transkription (ca. 30 % von Alt), die bei
Zugabe von mehr löslichem Protein auch nicht stark gesteigert werden kann. Im Vergleich
dazu sieht man bei der E. coli DNA, daß alterierte RNA-Polymerase keinen Einfluß auf die
Transkription von dieser DNA hat. Allerdings zeigt die Kontrolle aber auch keinen Einfluß
auf die Transkription, wenn man die Proteinmenge steigert. Es wäre zu erwarten gewesen,
daß bei Zugabe von mehr Protein, also auch mehr RNA-Polymerase, mehr Transkript
gebildet wird. Die Transkription mit modifizierter RNA-Polymerase zeigt hier auch wieder
den geringsten Einbau an Radioaktivität, der sich ebenfalls durch Zugabe von mehr Protein
nicht steigern läßt.
75
Ergebnisse
Abb. 3.29
Transkription von T4 DNA und E. coli DNA mit unveränderter, alterierter und
modifizierter E. coli RNA-Polymerase in löslichen E. coli Proteinrohextrakten. Im
linken Bild ist die Transkription von T4 DNA und im rechten Bild die Transkription
von der E. coli DNA wiedergegeben. Zum besseren Vergleich wurde die eingebaute
Radioaktivität in % angegeben, wobei der höchste Wert bei 30 µg löslichem Protein
auf 100 % gesetzt wurde. Die dargestellten Ergebnisse sind Mittelwerte aus zwei bis
drei unabhängigen Untersuchungen.
Die Auswirkungen einer alterierten und modifizierten RNA-Polymerase ließen sich nicht
untersuchen, da ModA in Gegenwart des Plasmides pTKRI nicht exprimiert wurde.
76
Diskussion
4 Diskussion
Zur Untersuchung von Proteinen werden diese in größeren Mengen benötigt. Aus den
natürlichen Quellen können aber oft nicht ausreichend Proteine isoliert werden. Hier liefert
die Gentechnik die entsprechenden Methoden, um über Klonierung und Expression der
gewünschten Gene an die gesuchten Proteine zu gelangen. Anschließend können die
gesuchten Proteine rekombinant hergestellt und isoliert werden, um Untersuchungen mit
ihnen durchzuführen.
4.1 Klonierung von modA und modB
Für die ADP-Ribosyltransferase Mod war der Locus auf dem T4 Genom bekannt (KUTTER
et al., 1994). Mod sollte zwischen den Genen 39 und 56, genauer hinter dem frühen
Promotor P13.149 liegen. An dieser Stelle befindet sich ein Operon, das aus zwei offenen
Leserahmen besteht. Eine Homologiesuche in den Datenbanken brachte keinen Aufschluß
darüber, welche der beiden Sequenzen für eine ADP-Ribosyltransferase kodiert, da keine
signifikante Übereinstimmung zu bekannten ADP-Ribosyltransferasen gefunden werden
konnte.
Erst
ein
Alignment
über
die
Sekundärstruktur
mit
anderen
ADP-
Ribosyltransferasen zeigte, daß beide Leserahmen für NAD(P)+-Arginin ADPRibosyltransferasen (EC 2.4.2.31) kodieren sollen (BAZAN & KOCH-NOLTE, 1997).
Das erste Ziel dieser Arbeit war somit beide Leserahmen zu klonieren, um die
entsprechenden Proteine rekombinant herzustellen. Des weiteren sollte die Sequenz, die für
das seit langem bekannte Mod kodiert, identifiziert werden. Das bekannte gpMod ist
dasjenige, welches die E. coli RNA-Polymerase ribosyliert (SEIFERT et al., 1969; SKORKO
et al., 1977). Es bestand aber auch die Möglichkeit, daß beide Enzyme die RNAPolymerase ribosylieren, oder daß Mod als Heterodimer aus beiden Proteinen aufgebaut
ist.
Die Klonierung der vollständigen Gene in einen allgemeinen Klonierungsvektor
(pBluescript II) gelang nicht, was zu der Überzeugung führte, daß beide Genprodukte für
E. coli toxisch sein müssen. Nach einer Beobachtung von BOUET et al. (1994) sind viele
Gene des Phagen T4 extrem toxisch für E. coli, was eine Klonierung dieser Gene sehr
erschwert. Klonierungen des Gens modA von MOSIG et al. (1998) lieferten nur inaktive
Mutanten des Gens, was ebenfalls auf die Toxizität des Proteins hindeutete.
77
Diskussion
Eine Klonierung in Vektoren bei denen die Expression unter der Kontrolle eines T7
Promotors steht, der nicht von der E. coli RNA-Polymerase erkannt wird (DUNN &
STUDIER, 1983; HAWLEY & MCCLURE, 1983), sollte eine frühzeitige Expression der Gene
unterbinden. Die T7 RNA-Polymerase ist bei der Elongation der RNA-Ketten fünf mal
schneller als die E. coli RNA-Polymerase (CHAMBERLIN & RING, 1973; GOLOMB &
CHAMBERLIN, 1974), was eine hohe Transkriptionsrate zur Folge hat. In einigen Fällen
kann die, von der T7 RNA-Polymerase katalysierte, Transkription sogar so hoch sein, daß
die Transkription von der Wirts RNA-Polymerase nicht konkurrieren kann und die
gesamte Transkription in der Zelle nur noch durch die T7 RNA-Polymerase stattfindet
(STUDIER & MOFFATT, 1986). Bei effizienten Translationssignalen kann so innerhalb von
drei Stunden das zu exprimierende Protein 50 % oder mehr des gesamten Zellproteins
ausmachen (STUDIER & MOFFATT, 1986).
Die ersten Klonierungsversuche, mit einem Gen unter der T7 Promotor Kontrolle,
erfolgten mit den Expressionsvektoren pT7-5 und pT7-6 (TABOR & RICHARDSON, 1985).
Eine Klonierung der kompletten Leserahmen von modA bzw. modB in diese Vektoren war
ebenfalls nicht möglich. Hier liegt die „Low-Level“ Expression der Gene so hoch, daß ein
toxisches Genprodukt das Wachstum der Zellen verhindert. Diese geringe Expression
findet von stromaufwärts vom T7 Promotor liegenden Sequenzen statt, die von der E. coli
RNA-Polymerase als schwache Promotoren erkannt werden können (eine T7 RNAPolymerase war zu diesem Zeitpunkt nicht in den Zellen vorhanden). Selbst durch die
Einführung einer Struktur für die ρ-abhängige Transkriptionstermination, einer
poly(dA)•poly(dT) Sequenz, die bei TOMASCHEWSKI (1988) die Klonierung des für E. coli
letalen T4 Gens 49 (Endonuklease VII) erlaubte, brachte nicht den gewünschten Erfolg.
Dabei sollte mit poly(dA) in 5'→3' Richtung die Transkription um 64 % gesenkt werden,
bei einer Orientierung des poly(dT) in 5'→3' Richtung wird die Transkription nur um 23 %
gesenkt und eine poly[d(A-T)] Sequenz zeigt keine Transkriptionsänderung (SHIGESADA &
IMAI, 1982).
Auch die Generierung eines Fusionsproteins mit der GST (Vektor pGEX-3X) brachte kein
Ergebnis. Anscheinend zeigt der Vektor pGEX-3X auch eine gewisse „Low-Level“
Expression, die Expression des klonierten Gens erfolgt hier von dem induzierbaren
artifiziellen tac-Promotor von E. coli. Das GST-Mod-Fusionsprotein scheint immer noch
aktiv und somit toxisch für die Zelle zu sein.
78
Diskussion
Nach diesen ersten Klonierungsversuchen war es unwahrscheinlich, daß Mod als
Heterodimer aus den beiden Proteinen aufgebaut sein sollte, da jede Komponente für sich
aktiv ist und eine letale Wirkung auf E. coli zeigt.
Die Zugabe von ADP-Ribosyltransferase Inhibitoren (3.3) in die Selektivagarplatten sollte
die Klonierung in die oben erwähnten Vektoren ermöglichen. Dazu wurden als Inhibitoren
3-Hydroxybenzamid (für Poly-ADP-Ribosyltransferasen) und Benzoylenharnstoff (für
Mono-ADP-Ribosyltransferasen) zugesetzt. Bei 1 mM Endkonzentration sollte eine
Hemmung von > 92 % erfolgen (BANASIK & UEDA, 1994). Diese Maßnahme zeigte
allerdings keine Auswirkung auf die Klonierungsergebnisse. Es konnten keine Klone mit
vollständigen mod Genen gefunden werden. Entweder wurden die Inhibitoren nicht von
den Zellen aufgenommen oder sie wurden abgebaut. Als weitere Möglichkeit kommt noch
in Betracht, daß sie zwar inhibitorisch auf andere ADP-Ribosyltransferasen wirken, aber
keinen hemmenden Effekt auf gpModA oder gpModB zeigen.
Erst in einem stringent kontrollierten Expressionssystem (pET-Vektoren (STUDIER &
MOFFATT, 1986), pBAD-Vektoren (GUZMAN et al., 1995)) konnten beide Gene vollständig
kloniert werden. Die Stringenz der pET-Vektoren wird zum Einen durch einen T7
Promotor, der wie bereits erwähnt, nicht von der E. coli RNA-Polymerase erkannt wird,
und zum Anderen durch den direkt hinter dem T7 Promotor liegenden lac-Operator
gewährleistet (STUDIER et al., 1990). Ist der Lac-Repressor an der Operatorsequenz
gebunden, wird die „Low-Level“ Transkription, die von der E. coli RNA-Polymerase
ausgeht, reprimiert. Eine Erhöhung der Stringenz während der Expression in DE3Stämmen wird durch die konstitutive Expression von T7 Lysozym (Vektoren pLysS oder
pLysE) erreicht, was einen natürlichen Inhibitor der T7 RNA-Polymerase darstellt
(MOFFATT & STUDIER, 1987; STUDIER, 1991; ZHANG & STUDIER, 1997). Durch Zugabe
von IPTG fällt der Lac-Repressor von der Operatorsequenz ab und es kann von diesem
Promotor transkribiert werden (Abb. 2.3).
Bei dem, durch Arabinose induzierbaren, pBAD-Vektor erfolgt eine strikte Kontrolle der
Expression durch das AraC Dimer und die Aktivierung der Transkription durch das CAP
Protein (GUZMAN et al., 1995). Beide Komponenten steuern die Expression, die von dem
PBAD-Promotor ausgeht und gewährleisten eine stringente Kontrolle (Abb. 2.4). In diesem
79
Diskussion
Expressionssystem soll zugleich eine proportionale Steuerung der Expression durch die
Induktorkonzentration (Arabinose) möglich sein (LEE, 1980; LEE et al., 1987).
Für die anschließende Reinigung der rekombinanten Proteine (4.6) wurden unter anderem
Fusionen mit einem C-terminalen oder N-terminalen „His-Tag“ generiert.
Wegen der Toxizität von ModA bzw. ModB für E. coli wurden Überlegungen angestellt,
ob nicht ein anderes Expressionssystem verwendet werden sollte. Es bestand die
Möglichkeit ein eukaryontisches System zu verwenden. Da man hier aber oft mit „ShuttleVektoren“ arbeitet, die vorher in E. coli vermehrt werden, war ein Erfolg fraglich. Gegen
das
eukaryontische
Expressionssystem
sprachen
auch
die
potentiellen
Glykosylierungsstellen in den beiden Proteinsequenzen: Es war nicht abzusehen, welchen
Einfluß eine mögliche Glykosylierung auf die Aktivität der Proteine haben könnte.
Eine Expression in Gram-positiven Bakterien z.B. Bacillus subtilis schien ebenfalls nicht
einfacher zu sein, da die ADP-Ribosylierung sehr unspezifisch ist und die toxische
Wirkung auch hier zur Entfaltung kommen könnte. Besonders für ModA ist hier
anzuführen, daß die α-Untereinheit der B. subtilis RNA-Polymerase ein dem Arg265
äquivalentes Arginin an der Position 261 aufweist. Dieses Arg261 könnte mit großer
Wahrscheinlichkeit ebenfalls von ModA ADP-ribosyliert werden und vielleicht toxisch für
B. subtilis sein.
4.2 Gründe für die Toxizität von ModA und ModB
Es überrascht, daß das gpAlt nicht ebenfalls eine toxische Wirkung auf E. coli hat, da im
Gegensatz zu ModA oder ModB viel mehr E. coli Proteine ADP-ribosyliert werden (Abb.
3.21). Alt kann konstitutiv exprimiert werden, ohne den Wuchs von E. coli negativ zu
beeinflussen (KOCH et al.,1995). Die Toxizität von ModA bzw. ModB muß also auf die
Ribosylierung unterschiedlicher Zielproteine zurückzuführen sein.
ModA
ModA ADP-ribosyliert beide α-Untereinheiten der RNA-Polymerase von E. coli. Durch
diese Modifikation werden keine UP-Element-abhängigen und CAP-abhängigen
Promotoren von E. coli mehr erkannt (siehe 4.8.1). Ob die Toxizität von ModA alleine auf
die Nichterkennung dieser Promotoren zurückzuführen ist, kann nur vermutet werden. Da
80
Diskussion
von ModA noch eine Vielzahl anderer Proteine modifiziert werden, die noch nicht
identifiziert sind, gibt es bis jetzt keine bessere Erklärung.
ModB
Vom T4 gpModB ist bisher nur bekannt, daß es das S1 Protein der 30S Untereinheit der
Ribosomen
modifiziert
(DEPPING,
1998).
Der
Phage
T7
phosphoryliert
die
Translationsinitiationsfaktoren IF1, IF2, IF3 und das S1 Protein von E. coli. Durch diese
Phosphorylierung soll der Translationsapparat des Wirtes bevorzugt die Phagen mRNA
rekrutieren (ROBERTSON & NICHOLSON, 1992). Durch eine ADP-Ribosylierung von S1
könnte ein solcher Mechanismus auch für den T4 zutreffen, zumal eine effiziente mRNA
Bindung durch die 30S Untereinheit ohne S1 nicht möglich ist (KOLB et al., 1977; BONI et
al., 1991; TZAREVA et al., 1994). Also könnte die Toxizität von ModB durch eine
verschlechterte Translation der E. coli mRNA verursacht sein. Durch ein ADPribosyliertes S1 könnte die E. coli mRNA vielleicht nicht mehr an die 30S Untereinheit
geladen werden. Genauso gut könnte die ADP-Ribosylierung aber auch eine essentielle
Funktion im Stoffwechsel von E. coli stören und somit die Vermehrung der Bakterien
verhindert sein.
4.3 Expression von ModA und ModB
4.3.1 Expression von ModA und ModB aus pET-Vektoren
Für die Expression aus pET-Vektoren wird die T7 RNA-Polymerase benötigt. Es gibt
mehrere Möglichkeiten die T7 RNA-Polymerase bereitzustellen und die Expression zu
induzieren. Eine Möglichkeit besteht darin die RNA-Polymerase mittels Phagen in die
Zelle zu bekommen. Dazu werden die Phagen CE6 (λ-Derivat) bzw. mGP1-2 (M13Derivat) verwendet. Die Induktion der Expression mit den Phagen CE6 bzw. mGP1-2 war
nicht sehr effektiv und brachte nicht den gewünschten Erfolg. Bei der Verwendung von
CE6 konnte nur eine geringe Überexpression erreicht werden. Womöglich war die
Infektionsrate, die mit einer „MOI“ von fünf angegeben war, zu gering und nicht alle
Bakterien konnten ModA bzw. ModB produzieren. Ebenso könnte aber auch in diesem
besonderen Fall die Expression der T7 RNA-Polymerase vom Phagengenom durch die
ADP-Ribosyltransferasen gestört worden sein. Bei der Infektion mit dem M13 Phagen
mGP1-2 wurde kein Mod exprimiert. Gründe dafür konnten nicht festgestellt werden. Da
81
Diskussion
die Expression der T7 RNA-Polymerase im Phagen mGP1-2 aber unter der Kontrolle des
CAP-abhängigen lac Promotors steht, könnte eine effektive Expression der T7 RNAPolymerase durch eine ADP-ribosylierte E. coli RNA-Polymerase unterbunden werden
(siehe auch 4.8.1). D.h. es wird anfangs etwas T7 RNA-Polymerase gebildet, durch das
Auftreten der ersten ModA Proteine, die die E. coli RNA-Polymerase ribosylieren, kann
jedoch kein weiteres Transkript für die T7 RNA-Polymerase synthetisiert werden und die
Expression des Zielproteins bleibt gering. Es gibt keine Hypothese warum ModB nach der
Infektion von mGP1-2 nicht exprimiert wurde, da die Zielproteine von ModB und die
Folgen ihrer ADP-Ribosylierung nicht bekannt sind.
Eine bessere Alternative waren DE3-Stämme, die den λ-Phagen DE3 lysogen im Genom
tragen, hier steht die Transkription der T7 RNA-Polymerase unter der Kontrolle des
Promotors lacUV5. Die Expression aus BLR(DE3), BL21(DE3) und seinen Mutanten
C41(DE3) und C43(DE3) hat ebenfalls den Vorteil, daß diesen Stämmen die Gene lon und
ompT fehlen, die für die Lon-Protease bzw. die äußere Membran-Protease OmpT kodieren,
die die Proteine während der Reinigung degradieren könnten (GRODBERG & DUNN, 1988).
Die Expression eines beliebigen Gens in einem E. coli – T7 RNA-Polymerase System hat
jedoch meistens toxische Auswirkungen auf E. coli, auch wenn das Genprodukt selbst
nicht giftig ist. Diese Toxizität während einer Protein Überexpression soll durch die
Entkoppelung von der Transkription und der Translation verursacht werden (IOST &
DREYFUS, 1995; MAKAROVA et al., 1995). Im E. coli Stamm C41(DE3) liegt das
Grundniveau der mRNA Synthese des klonierten Gens fünf mal niedriger als bei
BL21(DE3) und unter induzierten Bedingungen sogar 10 mal niedriger (MIROUX &
WALKER, 1996). Durch diese geringere mRNA Synthese findet keine Entkoppelung von
Transkription und Translation mehr statt. Unter induzierten Bedingungen vermehren sich
plasmidtragende C41(DE3) oder C43(DE3) weiter, während BL21(DE3) ihr Wachstum
einstellen (MIROUX & WALKER, 1996). Wie die Wuchskurven in Abb. 3.12 zeigen, weist
der Stamm BL21(DE3) einen deutlichen Wuchsnachteil mit kloniertem modA oder modB
unter nicht induzierten Bedingungen auf. Dieses verzögerte Wachstum hängt
möglicherweise mit dem oben erwähnten höheren Grundniveau der mRNA Synthese des
klonierten Gens zusammen.
82
Diskussion
Nach BARIK (1997) können Transformanden mit einer hohen Basalexpression bereits an
ihrem Aussehen erkannt werden. Erscheinen Kolonien von transformierten BL21(DE3)
opak, ist die basale Expression von dem klonierten Gen hoch, sehen sie durchsichtig aus,
weisen sie nur eine sehr geringe Basalexpression auf. Diese durchsichtigen Kolonien sind
den opak wirkenden in den meisten Fällen für die Überexpression vorzuziehen.
Die Verwendung von Antibiotika zur Selektion von plasmidtragenden Bakterien bedarf
ebenfalls einiger Beachtung. So fordert der Gebrauch von Ampicillin besondere Vorsicht
bei instabilen Plasmiden, da die β-Lactamase in das Medium abgegeben und hier sehr
schnell das Ampicillin durch Spaltung inaktiviert wird. Bei einer Bakterienkultur, die ein
instabiles Plasmid trägt, können nach Zerstörung des Ampicillins Bakterien ohne Plasmid
die Kultur sehr schnell überwachsen. Dies ist um so bedeutender, da sämtliches Ampicillin
bereits gespalten ist, wenn die Bakteriensuspension erst leicht trübe ist. Eine Erhöhung der
Ampicillinkonzentration hilft in diesem Falle nicht, der Zeitpunkt der kompletten
Inaktivierung wird dadurch nur geringfügig hinausgezögert (pET System Handbuch,
Novagen).
Bei der Anzucht von ModA oder ModB in DE3-Stämmen kam es vor Induktion der
Expression gelegentlich zur spontanen Lyse der Bakterien. Eine ähnliche Beobachtung
machten auch MOSIG et al. (1998). Bakterien lysierten in Flüssigkulturen spontan, wenn
sie ein Plasmid mit dem klonierten T4 Gen srd („similar to rpoD“, ähnlich zu σ70) trugen.
Der Stamm C41(DE3) mit pET-Vektoren, die modA enthalten, wächst unter induzierten
Bedingungen nicht auf Agar-Platten, aber in Flüssigkultur mit einem Vollmedium. Auf den
Agar-Platten kommt es wahrscheinlich zu lokalen Unterversorgungen von einigen
essentiellen Substanzen, so daß die entsprechenden Gene für die Synthese dieser Stoffe
durch den CAP-Faktor aktiviert werden müssen. Dies gelingt aber durch eine ADPribosylierte RNA-Polymerase nicht und es ist kein Wachstum zu verzeichnen. In
Flüssigkultur hingegen kommt es wahrscheinlich wegen der guten Durchmischung zu
keiner Limitierung dieser Substanzen und die Zellen können sich vermehren.
Aufgrund der hohen Transkriptionsrate von dem T7 Promotor aus und dem starken
Translationssignal der pET-Vektoren kam es während der Expression der Mod-Proteine
83
Diskussion
zur Bildung von Einschlußkörpern. Die Bildung von Einschlußkörpern kann von Vorteil
sein, wenn es eine effiziente Methode gibt, das Protein zu renaturieren. Isoliert man die
homogenen Einschlußkörper, kann das exprimierte Protein schon bis zu 90 % rein
vorliegen (LANGLEY et al., 1987).
4.3.1.1 Expression aus p32modA-His
Aus dem Vektor p32modA2 wurde der Vektor p32modA-His hergestellt, indem das trx
Gen eliminiert wurde. Somit sollte ein ModA Fusionsprotein gestaltet werden, das nur
einen C-terminalen „His-Tag“ trägt. Das trx wurde aus dem Vektor p32modA2 entfernt,
weil das denaturierte gpTrx-6His-ModA-6His besser an der Ni-NTA Matrix bindet als das
gp10His-ModA von p16modA7. Daraus wurde geschlossen, daß ein C-terminaler „HisTag“ eine bessere Bindung an der Matrix gewährleistet. Somit sollte eine bessere
Reinigung und Renaturierung über eine Ni-NTA Säule möglich sein. Um das Trx, das
nicht den gewünschten Einfluß auf die Löslichkeit hatte, nicht von dem Fusionsprotein
durch einen Proteinaseverdau nach der Reinigung zu entfernen, sollte das trx Gen aus dem
Vektor eliminiert werden. Später zeigte sich allerdings, daß das ModA-His mit dem Cterminalen „His-Tag“ nicht besser an der Ni-NTA Matrix bindet als His-ModA. Der Cterminale „His-Tag“ war anscheinend nicht alleine für die bessere Bindung an der Matrix
verantwortlich, sondern eher die gemeinsame Haftung des internen und C-terminalen „HisTags“.
Der generierte Vektor p32modA-His wies nach dem Entfernen des trx statt der 8
Nukleotide Spacer, optimal sollen 5 Nukleotide sein (GOLD, 1988; RINGQUIST et al., 1992;
CHEN et al., 1994), zwischen der SD-Region und dem Start-Codon AUG 11 Nukleotide
auf. Außerdem fehlen dem Exprimierten gpModA-His die ersten fünf Aminosäuren (Abb.
3.20), wie die entsprechende Nukleotidsequenz bei der Entfernung des trx verloren
gegangen sein könnte blieb ungeklärt. Bei dem Vorgängerplasmid (siehe auch 3.12), das
10 Nukleotide als Spacer enthielt, war keine Synthese von ModA-His nachzuweisen, da für
eine gute Translationseffizienz der Abstand zwischen der SD-Region und des Start-Codons
eine sehr wichtige Rolle spielt (CHEN et al., 1994). Die gute Expression aus dem Vektor
p32modA-His, mit den 11 Nukleotiden Spacer ist wahrscheinlich mit der guten
Übereinstimmung der sogenannten „Downstream Box“ mit der „Anti-Downstream Box“
der 16S rRNA zu erklären (SPRENGART et al., 1996). In Abb. 4.1 ist die Übereinstimmung
84
Diskussion
zwischen diesen beiden Sequenzen wiedergeben. Für eine gute Translation wird nicht
unbedingt eine SD-Region benötigt, eine gute Übereinstimmung, 7 – 8 komplementäre
Nukleotide, stromabwärts in der Nähe des Start-Codons mit der „Anti-Downstream Box“
der 16S rRNA ist für eine effiziente Proteinsynthese ausreichend (SPRENGART et al., 1996).
Position
„Anti-Downstream Box“ 1469
A G U A C U U A G U G U U U C
A G U A A U G C A A C U A A A A G A U U U U A A A A T A
Teil der mRNA von modA-His
1483
16S rRNA
p32modA-His
oder
Position
Abb. 4.1
„Anti-Downstream Box“ 1469
A G U A C U U A G U G U U U C
A G U A A U G C A A C U A A A A G A U U U U A A A A T A
Teil der mRNA von modA-His
1483
16S rRNA
p32modA-His
Vergleich der „Anti-Downstream Box“ mit einem Teil der mRNA von modA-His.
Die komplementären Nukleotide sind fett hervorgehoben und das Start-Codon ist
unterstrichen.
4.3.2 Expression von ModA aus dem pBAD-Vektor
Die Basalexpression der pBAD-Vektoren ist sehr gering und das Verhältnis von Induktion
zu Repression kann 1.200-fach sein, im Vergleich mit 50-fach bei Ptac-basierenden
Vektoren (GUZMAN et al., 1995). Da die Expression aus dem Vektor pBAD/HisB durch
die Induktormenge (Arabinose) reguliert werden kann, sollte eine Expression von ModA
aus diesem Vektor erfolgen, mit der Aussicht eine größere Menge lösliches und somit
natives ModA herzustellen.
Nach einer induzierten Überexpression von ModA und seinen Mutanten aus den Vektoren
pBADmodA2, pBADmodA2-R73K und pBADmodA2-E165D zeigte sich, daß die
rekombinanten Proteine zu keinem detektierbaren Anteil exprimiert wurden. Dies ist
wahrscheinlich darauf zurückzuführen, daß das Arg265 der α-Untereinheit der E. coli RNAPolymerase, welches ADP-ribosyliert wird, essentiell für die Erkennung von UP-Element
und CAP-abhängigen Promotoren ist (GAAL et al., 1996) (siehe auch 4.8.1). Da die
Transkription von dem Promotor PBAD CAP-abhängig ist, könnte dieser nach den ersten
gebildeten ModA Proteinen durch eine Ribosylierung der RNA-Polymerase nicht mehr
erkannt werden. Einen Hinweis auf die Richtigkeit dieser Vermutung liefert auch, daß eine
rpoA (Gen der α-Untereinheit) Mutante nicht auf Arabinose Medium wachsen kann. Die
85
Diskussion
verantwortliche Mutation befindet sich bei der Aminosäure Lys271 (GIFFARD & BOOTH,
1988), also in unmittelbarer Nähe des Arg265.
Da die beiden Mutanten immer noch eine schwache Ribosylierungsaktivität aufweisen,
schalten auch diese evtl. den Promotor durch eine ADP-Ribosylierung der RNAPolymerase aus. Wahrscheinlich könnte eine ModA Doppelmutante R73A, E165A, die
vollständig inaktiv sein sollte, von diesem Plasmid aus in einer löslichen Form exprimiert
werden.
Die Wuchskurven in Abb. 3.15 zeigen einen deutlichen Einfluß des Gens modA unter
induzierten Wuchsbedingungen. Die entsprechende Wuchskurve weist einen deutlich
flacheren Verlauf im Vergleich zum leeren Vektor auf. Dies könnte bedeuten, daß ModA
exprimiert wurde, die Mengen aber zu gering waren, um eine Expression erkennen zu
können.
4.4 Vermeidung von Einschlußkörpern
ModA lag nach der Expression aus den pET-Vektoren durchweg in Form von
Einschlußkörpern vor. Da es zu dieser Zeit noch keine effizienten Protokolle für die
Renaturierung von ModA gab und die ersten Versuche, die mit 7 M GuHCl denaturierten
Proteine zu renaturieren, nicht sehr effektiv waren, wurde versucht die Bildung der
Einschlußkörper zu vermeiden.
Die Hauptparameter, die zur Bildung von Einschlußkörpern führen sind in abnehmender
Reihenfolge
die
mittlere
Ladung
der
Aminosäuren
(Nettoladung/Anzahl
der
Aminosäuren), die „Turn“ bildenden Aminosäurereste, der Cysteingehalt, der Prolingehalt,
die Hydrophilizität und die Gesamtanzahl der Aminosäuren (WILKINSON & HARRISON,
1991). Die Ergebnisse der Auswertung nach diesen Kriterien zur Löslichkeit bzw.
Unlöslichkeit von Proteinen sind jedoch nicht immer ganz eindeutig. Nach SCHEIN &
NOTEBORN (1988) gibt es auch keinen Zusammenhang zwischen der Bildung von
Einschlußkörpern und der Proteinkonzentration oder der Produktionsrate. Faktoren, die die
Löslichkeit direkt beeinflussen sind möglicherweise mehr mit der Sekundärstruktur
verbunden als mit der Aminosäurezusammensetzung des Proteins (SCHEIN, 1989). Die cistrans Isomerisierung der Prolinreste könnte der limitierende Schritt während der Faltung
verschiedener Proteine sein (SCHEIN, 1989). Die Faltung zum nativen Protein kann somit
mehrere Minuten dauern (GUISE et al., 1996). Für ModA sollte die Faltung des Proteins
allerdings schnell vonstatten gehen, da zwei Minuten nach der T4 Infektion bereits aktives
86
Diskussion
ModA nachzuweisen ist. Durch eine hohe Translationsrate kommt es aber zu vielen
Faltungsintermediaten, die hydrophobe Oberflächen exponieren, wodurch die Proteine
aggregieren könnten (MITRAKI et al., 1987; MITRAKI & KING, 1989).
Rekombinante Proteine aggregieren oft, wenn E. coli bei 37° C kultiviert wird. Eine
Reduktion der Temperatur auf 30° C kann häufig eine Zunahme der nativen Proteine
bewirken, da die Rate der Proteinsynthese herabgesetzt ist (SCHEIN & NOTEBORN, 1988).
Im Falle von ModA brachte auch eine Kultivierung bei 16° C keine Verbesserung der
Expression von löslichem ModA.
Sollten die zu exprimierenden Proteine Faltungshelfer in Form von Chaperonen benötigen,
werden diese während der Expression ausgedünnt und können nicht mehr alle
neusynthetisierten Proteine bei ihrer Faltung in die native Form unterstützen. Die CoÜberexpression von Chaperonen kann somit zu einer Erhöhung des nativen Proteins
beitragen (GOLOUBINOFF et al., 1989; BUCHNER et al., 1991; BLUM et al., 1992). Der
nützliche Effekt der Chaperone ist allerdings nicht vorhersagbar, so daß die passende
Substrat-Chaperon Kombination erst herausgefunden werden muß (YASUKAWA et al.,
1995). So konnten BLUM et al. (1992) mit der Coexpression von DnaK die Löslichkeit des
menschlichen Wachstumshormons steigern und die Bildung von Einschlußkörpern
verringern. Die Coexpression von GroEL und GroES hingegen hatte keinen Einfluß auf die
Löslichkeit dieses Proteins. Mit der Coexpression der Hitzeschockproteine GroEL und
GroES war es aber möglich, die Ribulose-bisphosphat Carboxylase Oxigenase (Rubisco)
in ihrer nativen Form zu exprimieren. Diese Chaperone scheinen notwendig für den
Zusammenbau der Untereinheiten zu sein (GOLOUBINOFF et al., 1989).
Da die Chaperone in einer aufeinanderfolgenden Art und Weise zusammenarbeiten
(LANGER et al., 1992), könnte die Coexpression nur eines Chaperons nicht ausreichen, um
die Faltung in den nativen Zustand zu gewährleisten. So zeigte die Coexpression von
DnaK mit His-ModA oder Trx-ModA keinen erkennbaren Anstieg an löslichen
rekombinanten Protein. ModA scheint für die Faltung in den nativen Zustand nicht an das
Vorhandensein von DnaK angewiesen zu sein. Bei der Coexpression von GroEL und
GroES wurde kein ModA mehr exprimiert. Worauf dieses Phänomen zurückzuführen sein
könnte ist nicht bekannt. Es könnten Inkompatibilitäten zwischen den beiden Plasmiden
gewesen sein, oder durch die Anwesenheit des Vektors pGroESL waren die Vektoren mit
modA noch instabiler und wurden schneller von den Bakterien verloren.
87
Diskussion
Die Fusion mit einem hydrophilen Protein wie Thioredoxin (Trx) kann auch die
Löslichkeit erhöhen. So konnten mehrere Proteine, die vorher als Einschlußkörper
vorlagen, als Trx-Fusionsprotein löslich und in aktiver Form exprimiert werden (LAVALLIE
et al., 1993; HLAVAC & ROUER, 1997). Dabei weist das Trx noch andere nützliche
Eigenschaften auf. Es ist sehr hitzestabil und so kann eine Vorreinigung durch
Denaturierung bei 80° C von kontaminierenden E. coli Proteinen erfolgen. Durch einen
schnellen osmotischen Schock werden die Proteine Trx und EF-Tu aus der Zelle freigesetzt
und liegen somit nur mit wenigen Verunreinigungen vor. Im vorliegenden Fall ist die
Aggregationsfähigkeit des rekombinanten Proteins Trx-ModA anscheinend größer als die
Löslichkeit des Trx, da bei der Überexpression wieder nur Einschlußkörper gebildet
wurden. Warum ModA so stark zur Aggregation neigt ist unbekannt, zumal es keinen
ausgesprochen hydrophoben Charakter aufweist (Abb. 3.2).
Manche Proteine werden erst durch die Bildung von Disulfidbrücken stabilisiert, deren
Bildung im reduzierend wirkenden Cytoplasma von E. coli allerdings unterbunden ist.
ModA weist drei Cysteine in der Aminosäuresequenz auf, womit eine Disulfidbrücke
gebildet werden könnte. ModA sollte aber keine Disulfidbrücke aufweisen, da das
Cytoplasma von E. coli der Bereich ist, in dem ModA nach einer T4 Infektion gebildet
wird. Somit sollte auch ohne diese kovalente Bindung eine stabile, lösliche Struktur
gebildet werden können.
Die Sekretion von Proteinen in das Kulturmedium verhindert in manchen Fällen ebenfalls
die Bildung von Einschlußkörpern. Verwendet man ein porenbildendes Protein wie das
Bakteriocinfreisetzungsprotein (BRP), werden auch keine Signalsequenzen für den
Durchtritt durch die Zellwand benötigt. Dabei können die Proteine nicht nur aus dem
periplasmatischen Raum, sondern auch aus dem Cytoplasma freigesetzt werden (VAN DER
WAL et al.,1995). Während der Überexpression von ModA in Gegenwart des BRP konnte
keine Freisetzung von ModA in das Medium beobachtet werden, obwohl die Expression in
diesem System gut funktioniert hat, was man an der Menge des gebildeten ModA, das als
Einschlußkörper vorlag, sehen konnte. Es wurden jedoch eine Anzahl anderer Proteine im
Kulturüberstand gefunden. Ob diese freigesetzten Proteine nur aus dem Periplasma oder
auch aus dem Cytoplasma stammen ist unbekannt. Wenn auch aus dem Cytoplasma die
Proteine ausgeschleust wurden, was nach
VAN DER
WAL et al. (1995) geschieht, scheint
ModA schneller zu aggregieren, evtl. schon bei der Synthese an den Ribosomen, als daß es
aus der Zelle ausgeschleust werden könnte.
88
Diskussion
MOORE et al. (1993) konnten die Bildung von Einschlußkörpern verhindern, indem sie ein
angereichertes
Vollmedium
(Trypton-Phosphat-Medium
(2.5.1))
verwendeten.
Verschiedene T4-Proteine, wie die dCMP Deaminase, eine Endonuklease und andere
Proteine, konnten mit diesem Medium in löslicher und aktiver Form aus pET-Vektoren
exprimiert werden, was mit anderen Vollmedien nicht gelang. Dieses Medium ist
zusätzlich mit Phosphat gepuffert, da die Kontrolle des pH Wertes auch einen
entscheidenden Einfluß auf die Bildung von Einschlußkörpern hat. Die Bildung von
Einschlußkörpern nimmt zu, wenn der pH Wert sinkt, da der intrazelluläre pH den
Faltungsprozeß und die Konformation von Proteinen beeinflußt (STRANDBERG & ENFORS,
1991). Aber auch mit diesem Medium gelang es nicht, ModA in löslicher Form zu
exprimieren, selbst wenn man alle Parameter, die die Bildung von nativem Protein fördern,
wie niedrige Anzuchttemperatur, geringe Induktormenge und kurze Expressionszeit
zusammen anwendete.
4.5 Renaturierung von denaturierten Proteinen
Da die Bildung der Einschlußkörper durch keine der verwendeten Maßnahmen
unterbunden werden konnte, mußte versucht werden, die denaturierten Proteine in vitro zu
renaturieren. Das Auflösen und Renaturieren der Einschlußkörper kann ein limitierender
Faktor für die effiziente Herstellung von aktiven Proteinen aus E. coli sein. Da es keine
allgemeingültigen Regeln für eine effiziente Renaturierung gibt, muß für jedes Protein eine
neue Strategie gefunden werden. Dabei wird die Effizienz der Rückfaltung durch die
Proteinsequenz, dem Redoxpotential, dem Lösungsmittel, dem pH-Wert, der Ionenstärke
und der Konzentration des denaturierten Proteins beeinflußt (KOPETZKI et al., 1989).
Normalerweise werden Einschlußkörper in hohen Konzentrationen von chaotropen
Agenzien wie Harnstoff oder Guanidinium Hydrochlorid (GuHCl) aufgelöst. Dabei
stabilisiert Harnstoff den ungefalteten Zustand der Proteine, während GuHCl die
Wasserstoffbindungen stört und dadurch die Proteinstruktur auflöst (SCHEIN, 1990). Die
Verwendung von GuHCl ist dem Harnstoff jedoch vorzuziehen, da Harnstoff bei der
Zersetzung Isocyanate bilden kann und freie Amino- oder Thiolgruppen der Proteine
dadurch irreversibel geschädigt werden (HAGEL et al., 1971).
Wie oben dargelegt, spielt die Konzentration des denaturierten Proteins eine Rolle bei der
Renaturierung. Bei der Renaturierung entstehen Faltungsintermediate, bei denen
89
Diskussion
hydrophobe Bereiche noch an der Oberfläche liegen. Ist die Konzentration der Proteine zu
hoch, können diese Faltungsintermediate über diese hydrophoben Bereiche interagieren
und fallen dabei häufig aus. Diverse Versuche mit GuHCl denaturiertes ModA über
Dialyse oder Verdünnung zu renaturieren, brachten nur minimale Ausbeuten an löslichem
Protein (3.9). Wurden die verdünnten Proteinlösungen zentrifugiert, fand man einen
Proteinniederschlag. Wurde der Überstand danach eingeengt, viel noch einmal ein Teil des
Proteins aus.
Durch die Immobilisierung der „His-Tag“-Proteine an eine Ni-NTA Matrix können diese
effizient renaturiert werden, indem man das denaturierende Agens im Waschpuffer immer
weiter verdünnt (HOLZINGER et al., 1996; SHI et al., 1997). Der Erfolg beruht
wahrscheinlich darauf, daß die Proteine voneinander getrennt sind und es somit kaum zu
Protein-Protein Interaktionen kommen kann, die zu einer Aggregation der Proteine führen.
Für die Proteine ModA und ModB war diese Art der Renaturierung allerdings nur sehr
bedingt anwendbar, da trotz „His-Tag“ die denaturierten Proteine aus unbekannten
Gründen nur sehr schlecht an dem Säulenmaterial banden, und somit die Ausbeute an
renaturiertem Protein sehr gering war.
Eine weitere Methode, die die Rückfaltung von in GuHCl denaturierten Proteinen über
eine Gelfiltrations Chromatographie beschreitet (WERNER et al., 1994; CHAUDHURI et al.,
1996) wurde hier nicht angewendet, da die Mod Proteine selbst stark verdünnt noch zur
Aggregation neigen, und die Gefahr bestand, daß die Säule verstopft.
Es ist nur wenig über die strukturellen Eigenschaften der Einschlußkörper bekannt. OBERG
et al. (1994) konnten aber zeigen, daß die Einschlußkörper einen gewissen Anteil an
Sekundärstrukturen aufweisen. Durch die Denaturierung mit GuHCl oder Harnstoff
verlieren die Proteine ihre Sekundärstruktur (DILL & SHORTLE, 1991), die sie während der
Synthese an den Ribosomen bereits gebildet haben (PRZYBYCIEN et al., 1994; OBERG et al.,
1994). Dies ist einer der Hauptgründe für die schlechte Ausbeute der Wiederherstellung
des nativen Proteins aus Einschlußkörpern. MITRAKI et al. (1987) zeigten für die
3-Phosphoglycerat Kinase, daß schon bei einer Konzentration von 0,7 M GuHCl im Puffer,
eine Rückfaltung des Proteins zur nativen Form nur noch bedingt möglich ist. Sie konnten
ebenfalls zeigen, daß nach einer Renaturierung zwar sämtliche β-Strukturen wieder
vorhanden waren, aber 29 % der α-Helices ungefaltet blieben.
90
Diskussion
KHAN et al. (1998) nahmen an, daß die Renaturierung effektiver sein sollte, wenn man die
Sekundärstrukturen während der Lösung der Einschlußkörper nicht auflöst. Sie konnten
zeigen, daß man die Einschlußkörper bei einem pH von 12,0 und 2 M Harnstoff auflösen
kann, ohne die nativ-ähnliche Sekundärstruktur zu zerstören und die Rückfaltung zum
nativen Protein eine höhere Ausbeute erreicht, als es mit den herkömmlichen Methoden
mit hohen Konzentrationen von Harnstoff oder GuHCl möglich war.
So konnten selbst bei hohen Proteinkonzentrationen von bis zu 1 mg/ml für His-ModA
bzw. 3 mg/ml für Trx-ModA die Proteine mit hoher Ausbeute renaturiert werden (3.9.2).
ModA scheint allerdings nicht sehr stabil zu sein, da nach einigen Tagen Lagerung bei
-20° C ein Teil der Proteine ausfällt. Nach früheren Beobachtungen wußte man bereits, daß
ModA in vivo ebenfalls sehr instabil ist (GOFF, 1974; HORVITZ, 1974b). Nichts desto trotz
hat man mit diesem Verfahren der Renaturierung nun eine Methode in der Hand größere
Mengen ModA in aktiver Form zu gewinnen. So liegt die Ausbeute von angereicherten
ModA (isolierte Einschlußkörper mit ca. 90 % ModA) bei etwa 70 mg aus einer 500 ml
Expressionskultur.
4.6 Reinigung von ModA
Zur Reinigung der „His-Tag“ Proteine wurde die von PORATH et al. (1975; PORATH, 1992)
eingeführte immobilisierte Metallchelat-Affinitätschromatographie (IMAC) verwendet.
Diese Methode nutzt die starke Affinität von zweiwertigen Ionen wie Ni2+ zu
aufeinanderfolgenden Histidinresten (6 – 10 Stück) aus. Die gebundenen Proteine können
anschließend mit Imidazol oder bei pH 6,0 eluiert werden. Hierbei ist es möglich, ein
Protein in einem Schritt von weniger als 1 % Gesamtprotein auf über 95 % Homogenität
aufzureinigen (JANKNECHT et al., 1991). Die Aufreinigung unter denaturierenden
Bedingungen vermindert den Anteil an Fremdproteinen, da es zu keinen Protein-Protein
Interaktionen kommen kann, wie es unter nativen Bedingungen möglich ist (LEGRICE &
GRÜNINGER-LEITCH, 1990). Für die effiziente Reinigung des rekombinanten Proteins
ModA wurde eine N-terminale Fusion mit einer 10-Histidin-Sequenz („His-Tag“) oder
eine C-terminale Fusion mit einer 6-Histidin-Sequenz generiert. Die Reinigung unter
denaturierenden Bedingungen über eine Ni-NTA Säule war wie schon dargelegt nicht sehr
effektiv. Es wurde vermutet, daß evtl. der „His-Tag“ nicht mit exprimiert wurde. Das
Vorhandensein des „His-Tags“ wurde mit einem Ni-NTA Konjugat überprüft. Wie Abb.
3.16 zeigt, konnte der „His-Tag“ eindeutig nachgewiesen werden. Da ein Ni-NTA
91
Diskussion
Konjugat, also praktisch die gleiche Erkennung des „His-Tags“, wie an einer Ni-NTA
Matrix verwendet wurde, ist es nicht einsichtig, warum die Proteine nicht ebenfalls an der
Matrix binden.
Es sind zur Zeit mit ModA und ModB vier Proteine bekannt, die unter denaturierenden
Bedingungen nicht an Ni-NTA binden. Es bestand aber die Möglichkeit, daß ModA bzw.
ModB, wie die anderen beiden Proteine, unter nativen Bedingungen gereinigt werden
können (STEINERT persönliche Mitteilung (Firma Qiagen)). Mit der effizienten
Renaturierungsmethode (3.9.2) lag ausreichend natives His-ModA für eine Reinigung
unter nativen Bedingungen vor. Das renaturierte His-ModA bindet allerdings nicht mit den
Kapazitäten (5 – 10 mg Protein pro ml Säulenmaterial) wie der Hersteller sie angibt,
jedoch sehr viel besser als das denaturierte Protein an der Ni-NTA Matrix. Nach erfolgter
Elution von der Säule kann man eine Reinheit von 95 % und darüber erzielen (Abb. 3.17).
4.7 Mutanten von ModA und ModB
Nicht alle Aminosäuren eines Proteins sind für die katalytische Aktivität notwendig. Durch
ortsspezifische Mutagenese können die funktionellen und somit für die Katalyse
essentiellen
Aminosäuren
ermittelt
werden.
Das
Alignment
einiger
ADP-
Ribosyltransferasen (Abb. 1.9) zeigt konservierte Aminosäuren auf, die für die Funktion
des Enzyms relevant sein sollen. Wie in der Einleitung erläutert, zeigen alle bekannten
Strukturen der ADP-ribosylierenden Toxine eine Aushöhlung, in der die NAD+-Bindestelle
lokalisiert ist. Diese Mulde besteht aus 18 aufeinanderfolgenden Aminosäuren, die eine αHelix über ein β-Faltblatt bildet (Abb. 4.2). Diese Struktur wird von anderen β-Strängen
flankiert, die die katalytischen Seitenketten tragen. Dabei geht diese konservierte
dreidimensionale Struktur aber nicht auf konservierte Aminosäuren zurück. Für die
Cholera Toxin Gruppe ist ein Arginin in β1 hoch konserviert (Abb. 1.9). Ein konservativer
Austausch des nukleophilen Arginins gegen Lysin eliminiert die enzymatische Aktivität,
da das Lysin bei einem physiologischen pH protoniert vorliegt und somit keine Interaktion
mit der Amidgruppe des Nicotinamid vom NAD+ eingehen kann (LOBET et al., 1991;
BURNETTE et al., 1991). Eine weitere vollständig konservierte Aminosäure, die bei allen
ADP-Ribosyltransferasen zu finden ist, ist das Glutamat in β5 (Abb. 1.9). In vielen
Proteinen ist dieser Rest so wichtig, daß nicht einmal ein konservierter Austausch zu
Aspartat für die Enzymaktivität toleriert werden kann (TWETEN et al., 1985; PIZZA et al.,
1988).
92
Diskussion
Abb. 4.2
Schemazeichnung der NAD+-Bindetasche, die in allen ADPRibosyltransferasen vorhanden sein soll. Gezeigt wird die Interaktion des
Nicotinamidringes mit dem konservierten Arg/His Rest. Das katalytisch
essentielle Glu ist ebenfalls angegeben. (nach DOMENIGHINI et al., 1994)
In Tabelle 4.1 sind einige Untersuchungen aufgelistet, in denen die oben beschriebenen
katalytisch essentiellen Aminosäurereste durch ortsspezifische Mutagenese verifiziert
wurden. Nach diesen Ergebnissen und dem Alignment (Abb. 1.9) sollten für ModA die
Aminosäuren Arg72 und Glu165 an der Katalyse beteiligt sein, für ModB entsprechend
Arg73 und Glu173. In beiden Fällen wurden konservative Austausche der Aminosäuren
vorgenommen, d.h. Arg wurde gegen Lys und Glu gegen Asp ausgetauscht (3.11). Der
Austausch erfolgte über eine PCR, in der komplementäre Primer eingesetzt wurden, die die
Mutation tragen (2.6.4). Der Elternstrang wurde mit dem Restriktionsenzym DpnI, das
methylierte und hemimethylierte DNA erkennt, verdaut, so daß hauptsächlich der
neusynthetisierte und mutagenisierte Vektor für eine Amplifikation in E. coli transformiert
wurde. Eine Sequenzierung der Plasmide bestätigte die erfolgreiche Mutagenese.
93
Diskussion
Tabelle 4.1
Katalytisch aktive Aminosäuren einiger ADP-Ribosyltransferasen, die durch
Mutageneseexperimente identifiziert wurden.
Enzym
(Organismus)
Diphtherie Toxin
(Corynebacterium diphtherie)
Diphtherie Toxin
(Corynebacterium diphtherie)
Exotoxin A
(Pseudomonas aeruginosa)
Exotoxin A
(Pseudomonas aeruginosa)
Pertussis Toxin
(Bordetella pertussis)
Pertussis Toxin
(Bordetella pertussis)
hitzelabiles Enterotoxin
(Escherichia coli)
hitzelabiles Enterotoxin
(Escherichia coli)
C2 Toxin
(Clostridium botulinum)
C2 Toxin
(Clostridium botulinum)
Iota Toxin
(Clostridium perfringens)
Iota Toxin
(Clostridium perfringens)
C3-ähnliches Toxin
(Clostridium botulinum)
Cholera Toxin
(Vibrio cholerae)
Cholera Toxin
(Vibrio cholerae)
Mono-ADP-Ribosyltransferase
(Kaninchen)
Poly-ADP-Ribosyltransferase
(Mensch)
ModA
(Bakteriophage T4)
ModA
(Bakteriophage T4)
ModB
(Bakteriophage T4)
ModB
(Bakteriophage T4)
katalytisch
aktive
Aminosäure
His-21
Glu-148
His-440
Glu-553
Arg-9
Glu-129
Arg-7
Glu-112
Referenz
PAPINI et al., 1989
CARROLL & COLLIER, 1984;
TWETEN et al., 1985
CARROLL & COLLIER, 1988
CARROLL & COLLIER, 1987;
DOUGLAS & COLLIER, 1987
BURNETTE et al., 1988
BARBIERI et al., 1989
ANTOINE et al., 1993
LOBET et al., 1991
Arg-299
TSUJI et al., 1991
CIEPLAK et al., 1995
BARTH et al., 1998
Glu-389
BARTH et al., 1998
Arg-295
PERELLE et al., 1996
Glu-378
Glu-380
Glu-174
PERELLE et al., 1996
Arg-7
BURNETTE et al., 1991
Glu-112
TSUJI et al., 1991
Glu-240
TAKADA et al., 1995
Glu-988
MARSISCHKY et al., 1995
Arg-72
diese Arbeit
Glu-165
diese Arbeit
Arg-73
diese Arbeit
Glu-173
diese Arbeit
AKTORIES et al., 1995
94
Diskussion
Für eine schnelle und einfache Überprüfung der Aktivität der Mutanten von ModA und
ModB wurde der Plasmidstabilitätstest (STUDIER & MOFFATT, 1986; STUDIER et al., 1990)
modifiziert (2.5.4.3). In diesem Test macht man sich die Toxizität von ModA bzw. ModB
zu Nutze. Sind die entsprechenden Plasmide in den Stamm C41(DE3) transformiert, findet
man keine Koloniebildung auf IPTG-haltigen Agar-Platten. Die Bakterien bilden erst
Kolonien, wenn durch eine Mutation die toxischen Proteine nicht mehr gebildet werden
oder die Proteine selbst durch eine Mutation in ihrer Aktivität eingeschränkt sind.
Vergleicht man dann noch die Größe der Kolonien auf induzierenden und nicht
induzierenden Agar-Platten hat man einen guten Anhaltspunkt auf die Aktivität der
einzelnen Mutanten (Tabelle 3.3). So lag die Koloniegröße der generierten Mutanten unter
induzierten Bedingungen bei ca. 50 % von der unter nicht induzierten Bedingungen. Dies
bedeutet, daß die konservativen Austausche in ModA bzw. ModB zu keiner totalen
Inaktivierung der Proteine geführt haben, deren Aktivität aber so stark abgenommen hat,
daß sich Kolonien bilden konnten. Erst bei einem nicht konservativen Austausch des Arg72
zu Ala bei ModA findet man Kolonien gleicher Größe (NIVINSKAS persönliche
Mitteilung). Dies bedeutet, daß in diesem Fall wahrscheinlich keine Restaktivität von
ModA mehr zu verzeichnen ist. Beim Austausch des Glu165 gegen Ala bei ModA findet
sich keine vollständige Inaktivierung des Enzyms. Mit einer Koloniegröße von 70-80 %
liegt diese aber über der von der Mutante E165D. Also scheint hier die Aktivität durch
diesen nicht konservativen Austausch weiter gesunken zu sein. Einen größeren Einfluß auf
die Katalyse scheint das in unmittelbarer Nähe liegende Glu163 zu haben. Bei der Mutation
E163A wird ModA anscheinend vollständig inaktiviert. Aminosäureaustausche gegen
Alanin an den ebenfalls konservierten Aminosäuren Ser109, Phe127 und Phe129 in β2 bzw.
β3 (Abb. 1.9) scheinen ModA ebenfalls vollständig zu inaktivieren (Tabelle 3.3).
Bei Mutageneseuntersuchungen sollte man aber immer bedenken, daß ein einzelner
Aminosäureaustausch auch dazu führen könnte, daß ein Protein seine Tertiärstruktur
verliert und eine andere Konformation einnimmt. Dies würde wahrscheinlich ebenso eine
Inaktivierung des Proteins anzeigen, obwohl die entsprechende Aminosäure nicht an der
Katalyse beteiligt ist, sondern lediglich die Struktur des Proteins verändert wurde.
So zeigt die Sekundärstruktur Vorhersage der Mutanten ModA_E165D und ModA_E165A
in der Nähe der Mutation einen gravierenden Wechsel von einer α-Helix zu einem
β-Faltblatt (Abb. 4.3). Da die Mutante ModA_E165D in dem Plattentest aber noch eine
Restaktivität aufweist, scheint die Tertiärstruktur nicht wesentlich anders zu sein als beim
95
Diskussion
Wildtyp ModA. Somit scheint die Sekundärstruktur Vorhersage an dieser Stelle nicht ganz
zu stimmen. Bei der Mutante ModA_E165A liegt fast die gleiche Sekundärstruktur
Vorhersage vor wie beim Wildtyp, also wahrscheinlich auch die gleiche Tertiärstruktur.
Der Ausfall der Aktivität deutet darauf hin, daß Glu165 an der Katalyse beteiligt ist. Eine
letzte Sicherheit, daß diese oben genannten Aminosäuren an der Reaktion involviert sind,
könnte eine Kristallisation von ModA liefern. Aber auch die Cirkulardichroismus (CD)
Spektroskopie kann Anhaltspunkte darüber liefern, ob durch eine eingefügte Mutation sich
der Anteil an Helices oder Faltblättern verändert hat (FLANDERS et al., 1984; STRZELECKAGOLASZEWSKA et al., 1985).
ModA_Wildtyp
141 EYNPNFKFPDSHRYRNMELVSDEQEVMIPAGSVFRIADRYEYKKCSTYTIYTLDFEGFNL
ccccccccccccchhhhhhhcchhhhccccccceeeeceeccccccceeeeeecccceec
ModA_E165D
141 EYNPNFKFPDSHRYRNMELVSDEQDVMIPAGSVFRIADRYEYKKCSTYTIYTLDFEGFNL
ccccccccccccceeeeeeeecchhhhhccccceeeeceeccccccceeeeeecccceec
ModA_E165A
141 EYNPNFKFPDSHRYRNMELVSDEQAVMIPAGSVFRIADRYEYKKCSTYTIYTLDFEGFNL
ccccccccccccchhhhhhhhhhhhhhhccccceeeeceeccccccceeeeeecccceec
Abb. 4.3
Unterschiede in den Sekundärstruktur Vorhersagen von ModA_E165D und
ModA_E165A zum Wildtyp ModA. Die mutierte Aminosäure ist in Fettdruck
hervorgehoben. Die Vorhersage erfolgte nach dem Algorithmus von GARNIER et al.
(1996).
h: α-Helix; e: β-Faltblatt; c: ungeordnete Struktur
4.8 ADP-Ribosylierung durch ModA und ModB
Der erste Aktivitätstest nach ROHRER et al. (1975) mit löslichen Proteinrohextrakten einer
Überexpression zeigte, daß beide Proteine ADP-Ribosyltransferasen sind und nur das
Protein des zweiten Leserahmens die RNA-Polymerase markierte (Abb. 3.10). Somit
besitzt der Bakteriophage T4 nicht zwei, sondern drei ADP-Ribosyltransferasen, das Alt-,
das ModA- und das ModB-Protein. In diesem ersten Test wurden sehr wenige Proteine
radioaktiv markiert, was wahrscheinlich an der geringen Menge an löslichem Mod, einer
für so wenig Protein kurzen Reaktionszeit und an einer kurzen Exposition liegen könnte.
Bei
nachfolgenden
Aktivitätstests
mit
gereinigtem
Enzym
zeigten
sich
im
Autoradiogramm mehrere markierte Banden (Abb. 3.21). Diese Vielfalt der Markierungen
konnte in weiteren Versuchen mit löslichen Proteinüberständen ebenfalls nachvollzogen
96
Diskussion
werden. Die Generierung der zusätzlich markierten Banden liegt also nicht an einer
veränderten Faltung der Proteine nach der Renaturierung der Einschlußkörper, sondern
sind vielmehr eine Auswirkung der Konzentration an aktivem Protein.
Von den Proteinen, die durch ModA modifiziert werden, ist zur Zeit nur eines bekannt, die
α-Untereinheit der E. coli RNA-Polymerase und für ModB ist im Moment nur das S1
Protein der Ribosomen identifiziert. Inwiefern die anderen Markierungen auf die
Unspezifität der ADP-Ribosyltransferasen zurückzuführen sind (siehe auch 4.9), oder ob
sie einen Einfluß auf den Wirt oder die T4 Entwicklung haben, muß noch geklärt werden.
Bei der Verwendung von zwei oder allen drei ADP-Ribosyltransferasen in einem
Reaktionsansatz tritt kein erkennbarer synergetischer Effekt auf (Abb. 3.22). Es findet sich
lediglich eine Summierung der radioaktiven Markierungen. Somit scheint jede ADPRibosyltransferase des T4 unabhängig zu arbeiten, ohne einen Einfluß auf die anderen
beiden Transferasen auszuüben oder von ihnen beeinflußt zu werden.
Nicht infizierte E. coli zeigen ebenfalls eine ADP-Ribosylierung, die mit dem Alter der
Kultur zunimmt und evtl. eine signifikante Rolle im Übergang von der logarithmischen in
die stationäre Phase spielt (SKORKO et al., 1977; SKORKO & KUR, 1981). Dabei wird
jedoch nur ein Protein mit ca. 20 kDa in vivo markiert. Diese Markierung bei 20 kDa wird
in den in dieser Arbeit beschriebenen Kontrollansätzen nicht gefunden. Dies liegt
wahrscheinlich daran, daß bei SKORKO & KUR Gesamtprotein verwendet wurde und in den
erwähnten Kontrollen der vorliegenden Arbeit nur lösliches Protein verwendet wurde. Dies
würde bedeuten, daß das besagte 20 kDa Protein mit der unlöslichen Zellfraktion
sedimentierte. Die Markierung bei ca. 70 kDa wurde von SKORKO & KUR allerdings nicht
gefunden.
Unter in vitro Bedingungen wurden mit verschiedenen Proteinfraktionen von E. coli auch
noch diverse andere, nicht näher beschriebene Proteine markiert, dieses ADPribosylierende E. coli Enzym ist allerdings sehr instabil, es fällt aus und ließ sich nicht
weiter reinigen (SKORKO et al., 1977; SKORKO & KUR, 1981).
4.8.1 ADP-Ribosylierung der α-Untereinheit durch ModA
ModA ADP-ribosyliert die α-Untereinheit der E. coli RNA-Polymerase. Diese
Modifikation sollte mit einigen Auswirkungen auf die Transkription verbunden sein. So
97
Diskussion
wird die α-Carboxiterminale Domäne (αCTD) für die Interaktion mit stromaufwärts
liegenden Promotorelementen (UP-Elemente) benötigt, wie bei dem ribosomalen E. coli
Promotor rrnB P1 (ROSS et al., 1993; 1998). Die αCTD ist ebenfalls das Ziel für viele
Transkriptionsaktivatoren (ISHIHAMA, 1993), wie z.B. den Klasse I Aktivatoren (ZOU et
al., 1992; TANG et al., 1994). Von CAP (Katabolit Aktivator Protein) werden immerhin ca.
10 % aller E. coli Gene reguliert (ISHIHAMA, 1993). Das Arg265 scheint in diesen Fällen
eine besonders wichtige Rolle einzunehmen (ZOU et al., 1992). GAAL et al. (1996) konnten
zeigen, daß eine Mutation R265A in der αCTD für die Transkription von UP-Element
abhängigen Promotoren beinahe den gleichen Effekt hat, als würde der gesamte
Carboxyterminus fehlen. Wie Abb. 4.4 zeigt, kann der ADP-Ribosylrest den gesamten
Carboxyterminus überspannen und der große, negativ geladene Rest so die Interaktion mit
UP-Elementen oder Aktivatorproteinen unterbinden, aber auch neue Interaktionsflächen
für z.B. vom T4 neusynthetisierte Proteine liefern. Es ist möglich, daß die ADPRibosylierung am Arg265 die Aktivatoren und die stromaufwärts liegenden Bereiche der
ribosomalen Wirtspromotoren daran hindert die Transkription zu stimulieren und somit der
beobachtete schnelle Abfall der Wirtstranskription bei einer T4 Infektion verursacht wird
(ROSS et al., 1993). Außerdem könnte die ADP-Ribosylierung der α-Untereinheit eine
Rolle in der Verminderung der RNAP-Promotor Interaktion spielen, was die
Transkriptelongation beeinflußt (ADELMAN et al., 1998).
Für die Transkriptionsinitiation an Promotoren ohne UP-Elemente wird die αCTD nicht
unbedingt benötigt (IGARASHI & ISHIHAMA, 1991). Sie hat hier aber trotzdem eine
funktionelle Rolle, indem sie die Bildung des offenen Transkriptionskomplexes fördert
(BURNS et al., 1999).
Die Roh-abhängige Transkriptionstermination ist für die Genexpression und deren
Regulation sehr wichtig. Hier spielt die αCTD ebenfalls eine sehr wichtige Rolle.
Besonders die Aminosäuren Arg265, Gly296, Leu300, Ile303, Lys304, Asp305 und Leu307 werden
für eine effiziente Roh-abhängige Termination in vivo benötigt. Ihr Austausch gegen
Alanin hat teilweise den gleichen Effekt als würde der gesamte Carboxyterminus fehlen
(KAINZ & GOURSE, 1998).
98
Diskussion
Phe 249
Glu 329
Arg 317
Arg 310
Arg 255
Arg 284
Lys 271
Lys 304
Lys 291
Lys 298
Arg 265
Lys 297
ADP-Ribosylrest
Abb. 4.4
α-Carboxyterminus der E. coli RNA-Polymerase mit ADP-Ribosylrest am Arg265.
Die genaue Lage des ADP-Ribosylrestes ist nicht bekannt, die angegebene Position
beruht auf Vermutungen. Es sind das Ende und der Anfang der αCTD sowie
sämtliche Arginine und Lysine angegeben.
Es wurde gezeigt, daß die ADP-ribosylierte RNA-Polymerase von den mittleren T4
Promotoren aus nicht sehr gut transkribiert. Hier wird die Transkription durch MotA
(„modifier of transcription“ von T4) aber aktiviert, da erst durch MotA die Bildung des
offenen Transkriptionskomplexes erreicht werden kann (HINTON et al., 1996). Die
unmodifizierte E. coli RNA-Polymerase kann von den mittleren T4 Promotoren
transkribieren, es wird hier die erweiterte –10 Sequenz (TGNTATAAT) erkannt, aber die
Transkription kann nicht mehr durch MotA stimuliert werden (HINTON, 1991; SCHMIDT &
KREUZER, 1992). In Gegenwart von AsiA (Antisigmafaktor von T4) wird die
unmodifizierte RNA-Polymerase wieder durch MotA aktiviert und die Transkription von
den mittleren Promotoren gesteigert (OUHAMMOUCH et al., 1995; HINTON et al., 1996).
Des weiteren wird die Transkription an den frühen Promotoren durch AsiA vermindert,
wodurch von der frühen auf die mittlere Transkription umgeschaltet wird (OUHAMMOUCH
et al., 1994; 1995).
99
Diskussion
Die ADP-ribosylierte RNA-Polymerase erkennt also keine Promotoren mit erweiterter
-10 Region, und die Kontakte der α-Untereinheit mit der DNA und Aktivatoren geht
verloren, was einmal die Erkennung der entsprechen Wirtspromotoren unterdrückt, aber
auch die Transkription von mittleren T4 Promotoren während der frühen Infektionsphase
verhindert. Diese Einschränkungen in der Promotorerkennung der Wirts DNA verursachen
womöglich die Toxizität von ModA.
Für die Erkennung und erhöhte Transkription von späten T4 Promotoren wird die
carboxyterminale Domäne der α-Untereinheit nicht benötigt (TINKER et al., 1995), somit
hat die ADP-Ribosylierung des Arg265 keinen Einfluß auf die Transkription dieser späten
Promotoren. RABUSSAY & GEIDUSCHEK (1977b) haben allerdings gezeigt, daß T4
modifizierte RNA-Polymerase für eine solide Stimulation der späten T4 Promotoren
benötigt wird. Diese beiden Aussagen stehen nicht unbedingt im Widerspruch zu einander,
da RABUSSAY & GEIDUSCHEK (1977b) T4 DNA, die 5-Hydroxymethylcytosin anstelle von
Cytosin besitzt verwendet haben und diese modifizierte DNA normalerweise notwendig
für die Synthese von späten Proteinen sein soll (zusammengefaßt bei RABUSSAY &
GEIDUSCHEK, 1977a). TINKER et al. (1995) haben jedoch für ihre Untersuchungen späte
Promotoren verwendet, die auf Plasmiden liegen und somit Cytosin enthalten. Der
gefundene Unterschied mag also bei den verschiedenen DNA Typen liegen.
4.9 ADP-Ribosyltransferase Aktivität von ModA
Da den ADP-Ribosyltransferasen offensichtlich eine Spezifität für die Seitenkette der
Guanidinderivate fehlt (MOSS & VAUGHAN, 1977; 1978; MOSS et al., 1979; MEKALANOS et
al., 1979), können künstliche Substrate für Aktivitätstests eingesetzt werden (S OMAN et al.,
1983; 1984).
Im Gegensatz zu vielen bakteriellen ADP-Ribosyltransferasen, die für in vitro
Untersuchungen erst aktiviert werden müssen (PASSADOR & IGLEWSKI, 1994), sind die
Transferasen des T4 von Anfang an aktiv.
Die Aktivität von ModA wurde mit einem photometrischen Test ermittelt, wobei das
artifizielle Substrat p-Nitrobenzylidin-aminoguanidin (NBAG) eingesetzt wurde. Das
Substrat NBAG mußte für diesen Versuch erst hergestellt werden (2.8.2.1). Zur
Überprüfung, ob die richtige Substanz synthetisiert wurde, wurde ein Wellenlängenscan
von 230 – 550 nm durchgeführt und mit den Scans der Ausgangsmaterialien und dem Scan
für NBAG von SOMAN et al. (1983) verglichen. Es zeigte sich, daß NBAG synthetisiert
100
Diskussion
wurde und keine erkennbaren Verunreinigungen zu finden waren. In dem entsprechenden
Test wird das NBAG nur mono-ADP-ribosyliert (SOMAN et al., 1983; 1984). Dieser
Hinweis muß bedacht werden, damit die Reaktionsgeschwindigkeit richtig bestimmt
werden kann.
Bei diesem Versuch ist es sehr wichtig, daß während der Durchführung der pH-Wert
konstant gehalten wird, da die Methode auf der Änderung des pKa von NBAG basiert
(Erniedrigung von 0,7 – 0,8 pH Einheiten) (SOMAN et al., 1983). Deshalb kann diese
Methode auch nicht über einen weiten pH-Bereich angewendet werden. Nach SKORKO et
al. (1977) liegt das pH-Optimum für ModA bei 7,5 und das Temperaturoptimum zwischen
15° C und 20° C. Also sollte bei diesem Test (pH 7,4) keine große Aktivitätseinbuße von
ModA zu befürchten sein. Außerdem war schon bekannt, daß ModA kein Mg2+ benötigt
und nicht durch EDTA inhibiert wird, des weiteren wird es durch Sulfhydryl-Reagenzien
geschützt und Nicotinamid ist ein Inhibitor für die Reaktion (SKORKO et al., 1977).
Bei der Aktivitäts-Untersuchung von ModA unterliegt man jedoch einer gewissen
Gradwanderung, da ModA bei einer niedrigen Ionenstärke instabil ist, die Aktivität aber
durch eine hohe Ionenstärke inhibiert wird (SKORKO et al., 1977).
Vor der Bestimmung von Vmax und KM wurde überprüft, ob unter den gegebenen
Bedingungen ein linearer Zusammenhang in Abhängigkeit der Proteinkonzentration
besteht. Die Linearität wurde bestätigt, was bedeutet, daß es unter der gegebenen
Versuchsanordnung zu keiner Limitierung der Substrate kam. Im Anschluß wurden die
Werte für Vmax und KM in Abhängigkeit beider Substrate (NAD+, NBAG) bestimmt. Dabei
gibt der KM Wert die Substratkonzentration an, bei der die Hälfte der aktiven Zentren
besetzt sind. Es wurde ein KM für NAD+ von 258 µM und für NBAG von 219 µM, also ein
fast identischer Wert ermittelt. In Tabelle 4.2 sind zum Vergleich KM-Werte einiger ADPRibosyltransferasen aufgeführt. Der Wert, der von SKORKO et al. (1977) für ModA
ermittelt wurde liegt um den Faktor 18 niedriger als der in dieser Arbeit ermittelte Wert.
Diese Abweichung kann nur durch die unterschiedlichen Versuchsbedingungen erklärt
werden.
Die Werte für Vmax variieren stärker. Der Wert für Vmax(NAD+) liegt bei 20 mol Produkt
h-1
.
mol ModA-1 und Vmax(NBAG) bei nur 5,3 mol Produkt
.
h-1
.
.
mol ModA-1. Die
Reaktionsgeschwindigkeit in Abhängigkeit von NBAG liegt wahrscheinlich höher, da
101
Diskussion
ModA sich selbst ribosyliert und diese Ribosylierung bei wenig vorhandenem NBAG
stärker zu tragen kommt und mit diesem Testverfahren nicht registriert werden kann.
Man hat es hier mit einer enzymatischen Reaktion mit zwei Substraten zu tun (wenn man
ModA, das sich autoribosyliert mitzählt, sind es sogar drei Substrate). Da in den
Reaktionsansätzen ein Substrat (entweder NAD+ oder NBAG) aber immer konstant im
Sättigungsbereich gehalten wurde, kann man sie wie eine Reaktion mit einem Substrat
behandeln. Eine enzymatische Reaktion mit einem Substrat folgt nach Michaelis und
Menten folgender Gleichung:
k1
E n zy m + S u b strat
S
E
k2
E n zy m -S u b stra t-K o m p lex
ES
k3
E n zy m + P ro d u k t
E
P
(k2 + k3)
k1
Für KM gilt:
KM =
Für k3 « k2 gilt:
k2
KM = k
1
Für die Reaktionsgeschwindigkeit gilt nach Michaelis und Menten folgende Gleichung:
[S]
V = Vmax [S] + K
M
Wenn k2 wesentlich größer als k3 ist zeigt ein hoher KM-Wert eine schwache und ein
niedriger KM-Wert eine feste Bindung des Substrates zum Enzym an.
Tabelle 4.2
KM-Werte verschiedener ADP-Ribosyltransferasen.
Protein
ADP-Ribosyltransferase
Substrat
NAD+
KM (µM)
Referenz
30
MOSS et al., 1979
aus Vogelerythrocyten
NADP+
30
Cholera Toxin
NAD+
4000
MOSS et al., 1976
E. coli Enterotoxin
NAD+
8000
MOSS & RICHARDSON, 1978
Pertussis Toxin
NAD+
2
ModA
NAD+
14,3
SKORKO et al., 1977
ModA
NAD+
258
diese Arbeit
FINCK-BARBANCON & BARBIERI, 1995
102
Diskussion
Die katalytische Konstante kkat von ModA wurde für NAD+ mit 0,334 Umsätzen pro
Minute bestimmt. In Tabelle 4.3 sind die kkat-Werte einiger ADP-Ribosyltransferasen
angegeben. ModA hat eine relativ geringe Aktivität. Sie liegt um einen Faktor von ca. 180
unter der des Diphtherie Toxins, aber auch um einen Faktor 1000 höher als bei dem C3ähnlichem Toxin von Clostridium limosum.
Tabelle 4.3
Katalytische Konstanten (kkat) einiger ADP-Ribosyltransferasen.
Protein
C2 Toxin
C3-ähnliches Toxin
kkat (min-1)
1,77
Referenz
BARTH et al., 1998
0,00033
BÖHMER et al., 1996
Diphtherie Toxin
58,8
WILSON et al., 1990
E. coli Enterotoxin
0,65
CIEPLAK et al., 1995
Alt-Protein vom T4
0,028
KOCH, 1999
ModA
0,334
diese Arbeit
4.10
Transkriptionsversuche mit alterierter und modifizierter E. coli RNAPolymerase
Die ADP-Ribosylierung der E. coli RNA-Polymerase hat einen Einfluß auf die
Transkription. MAILHAMMER et al. (1975) konnten zeigen, daß modifizierte RNAPolymerase unter in vitro Bedingungen von E. coli DNA weniger mRNA synthetisiert als
normale RNA-Polymerase. Unter den gleichen Bedingungen wurde die mRNA Bildung
von T4 DNA durch modifizierte RNA-Polymerase jedoch nicht beeinträchtigt, was darauf
hindeutet, daß die Genexpression der Wirtszelle durch die ADP-Ribosylierung zum Teil
ausgeschaltet wird. Dabei zeigte sich die normale RNA-Polymerase 4 bis 15 mal effektiver
an bestimmten E. coli Promotoren als die modifizierte RNA-Polymerase. Sie konnten
zeigen, daß die unmodifizierte α-Untereinheit essentiell für die effiziente Transkription des
lac Promotors ist.
In einem in vivo System konnte man zeigen, daß alterierte RNA-Polymerase die
Transkription von vielen frühen T4 Promotoren steigert (WILKENS & RÜGER, 1996). Jetzt
sollte im Vergleich die Auswirkung von modifizierter RNA-Polymerase (RNAP)
untersucht werden. Experimente mit gereinigter RNAP, die während des laufenden
Versuchs durch Alt oder ModA ADP-ribosyliert werden sollte, zeigten keine Veränderung
in der Transkriptionsrate. Entweder fehlten zusätzliche Komponenten in dem
103
Diskussion
Reaktionsansatz, die mit der ADP-ribosylierten RNAP interagieren, oder die Ribosylierung
durch Alt bzw. ModA lief in dem Versuchsansatz zu langsam ab, so daß während der
Versuchsdauer kein Einfluß auf die Transkription festzustellen war. Deshalb wurde ein
„halb in vivo“ System, bei dem die löslichen Proteine einer überexprimierenden Kultur
eingesetzt wurden, verwendet. Es wurde die Transkription von genomischer DNA von T4
bzw. E. coli untersucht. Von der T4 DNA wird in diesem System nur von den frühen
Promotoren transkribiert, da die Proteine AsiA und MotA, die für die Transkription der
mittleren Promotoren notwendig sind, fehlen. Eine Transkription von den späten
Promotoren erfolgt ebenfalls nicht, da gp55, gp33 und der gp44-gp62 Komplex fehlen.
Von T4 DNA läßt sich mit alterierter RNA-Polymerase durch Zugabe von mehr löslichem
Proteinextrakt die Transkriptmenge steigern (Abb. 3.29). Bei unveränderter oder
modifizierter RNAP ist eine solche Steigerung nicht festzustellen. Mit modifizierter RNAP
erzielt man außerdem nur zwischen 30% und 50% der Transkriptmenge wie von der
normalen RNAP. Dies bedeutet, daß modifizierte RNAP von T4 DNA schlechter
transkribiert als normale RNAP. Der Unterschied kommt wahrscheinlich daher, daß
normale RNAP auch von den mittleren Promotoren transkribiert, was die modifizierte
RNAP nicht kann (siehe auch 4.8.1). Die ADP-Ribosylierung der zweiten α-Untereinheit
durch ModA bewirkt anscheinend, daß die gute Transkription der frühen T4 Promotoren
durch die alterierte RNAP stark eingeschränkt und somit die frühe Transkription fast
eingestellt wird.
Bei der Transkription von E. coli DNA zeigen alterierte und normale RNAP ein fast
identisches Verhalten. Durch Zugabe von mehr löslichem Proteinextrakt konnte in beiden
Fällen nicht mehr Transkript gebildet werden. Für die normale RNAP wäre zu erwarten
gewesen, daß mit mehr Protein auch mehr Transkript gebildet wird. Es sei denn, daß mit
der eingesetzten Proteinmenge am Anfang des Versuchs schon so viel RNAP im Ansatz
ist, daß sämtliche Promotoren auf der vorhandenen DNA bereits „ausgelastet“ sind.
Übereinstimmend mit der T4 DNA zeigt die modifizierte RNAP bei der E. coli DNA
wieder eine nur geringe Transkriptbildung. Dies könnte ein Hinweis darauf sein, daß durch
die modifizierte RNAP ein Teil der E. coli Promotoren abgeschaltet wird, was wohl zu
dem beobachteten Zusammenbruch der E. coli Transkription beitragen könnte (GOLDFARB
& PALM, 1981). Der Zusammenbruch der bakteriellen RNA-Synthese findet in alt -, mod Mutanten aber immer noch statt (GOFF & SETZER, 1980), so ist ModA nicht alleine dafür
Verantwortlich, könnte aber einen Teil dazu beitragen.
104
Diskussion
Man sollte bei diesen in vitro Versuchen aber bedenken, daß die RNA-Polymerase von
vielen zusätzlichen Stellen, wie Einzelstrangbrüchen in der DNA, transkribieren kann, die
keine Promotoren darstellen und es somit zu einer falschen Aussage kommen kann.
Es bleibt noch viel zu tun, um die Auswirkungen der drei ADP-Ribosyltransferasen des
Bakteriophagen T4 auf seinen Wirt E. coli, aber auch auf seine eigene Entwicklung
vollständig zu verstehen.
105
Zusammenfassung
5 Zusammenfassung
Die ADP-Ribosylierung ist eine weit verbreitete posttranslationale Modifikation von
Proteinen, die bei Viren, Prokaryonten und Eukaryonten auftritt und zur Regulation
diverser Stoffwechselprozesse eingesetzt wird. Obwohl die Familie der ADPRibosyltransferasen kaum Homologien in der Aminosäuresequenz aufweisen, zeigen sie
doch eine gemeinsame Struktur, die das katalytische Zentrum bildet. Anhand der
Sekundärstruktur kann ein Alignment der bekannten ADP-Ribosyltransferasen angefertigt
werden. Das Alignment zeigt einige hoch konservierte Aminosäuren, die wahrscheinlich
für die Katalyse notwendig sind.
Vom Bakteriophagen T4 waren zwei, für ihn nicht essentielle, ADP-Ribosyltransferasen
bekannt, das gpAlt und das gpMod. Die Auswirkungen von Alt auf die frühen T4
Promotoren sind bereits bekannt, nun sollte die Auswirkung von Mod auf die
Transkription untersucht werden. Dazu mußte zuerst das Gen für Mod kloniert werden. Es
gab zwei potentielle Kandidaten, die das Gen mod sein konnten. Die Gene liegen in einem
Operon hinter dem frühen T4 Promotor P13.149. Bei den Klonierungsarbeiten stellte sich
heraus, daß beide Genprodukte toxisch für E. coli sind. Eine Klonierung konnte somit erst
in stringent kontrollierten Vektoren wie den pET-Vektoren oder dem Vektor pBAD
erfolgen.
Aktivitätstests mit beiden Genprodukten zeigten, daß es sich bei beiden Proteinen um
ADP-Ribosyltransferasen handelt. Somit besitzt der Bakteriophage T4 drei ADPRibosyltransferasen, das gpAlt, das gpModA und das gpModB. Die drei Proteine zeigen
unterschiedliche Ribosylierungsmuster in SDS-Polyacrylamidgelen, wobei einige Proteine
von zwei der drei Transferasen ribosyliert werden. So z.B. die α-Untereinheit der E. coli
RNA-Polymerase. Sie wird durch Alt und ModA ADP-ribosyliert.
Die Proteine ModA und ModB werden als Einschlußkörper exprimiert. Es wurden keine
Anzuchtbedingungen gefunden, die lösliches Protein lieferten. Auch die Coexpression von
Chaperonen, der Versuch die exprimierten Proteine in das Kulturmedium zu bringen oder
die Fusion mit Thioredoxin änderten nichts an der Bildung der Einschlußkörper. Aber
durch die Isolierung der Einschlußkörper kann ModA bereits zu > 90 % sauber vorliegen.
Zu diesem Zeitpunkt ist es allerdings inaktiv und muß noch renaturiert werden.
106
Zusammenfassung
Die Renaturierung der mit 7 M GuHCl oder 8 M Harnstoff behandelten Einschlußkörper
von ModA ist nicht sehr effektiv. Werden diese Einschlußkörper aber bei einem pH 12 und
2 M Harnstoff aufgelöst, können sie leicht durch Dialyse renaturiert werden. Jedoch ist
ModA nicht sehr stabil und es fällt mit der Zeit aus.
Eine Reinigung von rekombinanten ModA bzw. ModB, die mit einem „His-Tag“ versehen
sind, ist unter denaturierenden Bedingungen nur bedingt möglich. Aus unbekannten
Gründen hat der „His-Tag“ unter denaturierenden Bedingungen eine schlechte Affinität zur
Ni-NTA Matrix. Ein „His-Tag“ am nativen Protein bindet besser an Ni-NTA, wodurch
ModA bzw. ModB weiter gereinigt werden können. Für das gereinigte ModA wurde ein
KM-Wert für NAD von 258 µM und für NBAG von 219 µM ermittelt. Die kkat-Werte
liegen für NAD bei 0,334 min-1 und für NBAG bei 0,089 min-1.
Der Austausch bestimmter Aminosäuren gibt Aufschluß über die Notwendigkeit dieser
Aminosäuren für die Katalyse. Als katalytisch wirksame Aminosäuren wurden die für
ModA postulierten Aminosäuren Arg72 und Glu165 und für ModB die Aminosäuren Arg73
und Glu173 durch ortsspezifische Mutagenese verifiziert. Der homologe Austausch je einer
der genannten Aminosäuren zeigte eine verminderte Aktivität der toxischen Proteine, was
für eine Beteiligung an der Reaktion oder für eine Beteiligung an der Bindung des
Substrats spricht. Für die erzeugten Mutanten müssen die Werte für KM und Vmax noch
bestimmt werden, um Anhaltspunkte zu erlangen ob die mutierten Aminosäuren an der
Katalyse oder der Substratbindung beteiligt sind.
Da ModA die α-Untereinheit der E. coli RNA-Polymerase modifiziert, liegt es nahe, eine
Auswirkung auf die Transkription zu vermuten. Untersuchungen zur Transkription mit
modifizierter RNA-Polymerase von genomischer T4 bzw. E. coli DNA zeigen, daß die
Transkription im Vergleich zu alterierter oder unveränderter RNAP, deutlich geringer ist.
Es ist somit zu vermuten, daß durch die modifizierte RNAP einige Promotoren nicht mehr
erkannt werden können. Während einer T4 Infektion liegt erst eine alterierte RNAP vor,
die gut von den frühen T4 Promotoren transkribieren kann. Durch eine Modifikation der
RNAP wird die Transkription von diesen frühen Promotoren teilweise unterbunden und
durch die Synthese von AsiA und MotA auf die mittleren Promotoren umgeschaltet.
107
Literaturverzeichnis
6 Literaturverzeichnis
Adelman, K., Brody, E.N., & Buckle, M. (1998). Stimulation of bacteriophage T4 middle
transcription by the T4 proteins MotA and AsiA occurs at two distinct steps in the
transcription cycle. Proc.Natl.Acad.Sci.U.S.A., 95, 15247-15252.
Aktories, K., Jung, M., Bohmer, J., Fritz, G., Vandekerckhove, J., & Just, I. (1995). Studies on
the active-site structure of C3-like exoenzymes: involvement of glutamic acid in catalysis
of ADP-ribosylation. Biochimie, 77, 326-332.
Altschul, S.F., Gish, W., Miller, W., Myers, E.W., & Lipman, D.J. (1990). Basic local alignment
search tool. J.Mol.Biol., 215, 403-410.
Antoine, R., Tallett, A., van, H.S., & Locht, C. (1993). Evidence for a catalytic role of glutamic
acid 129 in the NAD- glycohydrolase activity of the pertussis toxin S1 subunit.
J.Biol.Chem., 268, 24149-24155.
Ausubel F.M., Brent R., Kingston R.E., Moore D.D., Seidman J.G., Smith J.A., & Struhl K.
(1993). Current protocols in molecular biology. In Current protocols in molecular
biology. Greene Publishing and Wiley-Interscience, New York.
Baiocchi F., Cheng C.C., Haggerty W.J., Jr., Lewis L.R., Liao T.K., Nyberg W.H., O´Brien
D.E., & Podrebarag E.G. (1963). Studies on Methylglyoxal Bis(guanylhydrazone)
Analogs. II. Structural variations on Methylglyoxal Bis(guanylhydrazone). J.Med.Chem.,
6, 431-445.
Banasik, M., & Ueda, K. (1994). Inhibitors and activators of ADP-ribosylation reactions.
Mol.Cell Biochem., 138, 185-197.
Barbieri, J.T., Mende-Mueller, L.M., Rappuoli, R., & Collier, R.J. (1989). Photolabeling of Glu129 of the S-1 subunit of pertussis toxin with NAD. Infect.Immun., 57, 3549-3554.
Barik, S. (1997). Relationship between opacity of transformed E. coli colonies and overexpression of the recombinant transcript. Biotechniques, 22, 112-118.
Barth, H., Preiss, J.C., Hofmann, F., & Aktories, K. (1998). Characterization of the catalytic site
of the ADP-ribosyltransferase Clostridium botulinum C2 toxin by site-directed
mutagenesis. J.Biol.Chem., 273, 29506-29511.
Bazan, J.F., & Koch-Nolte, F. (1997). Sequence and structural links between distant ADPribosyltransferase families. Adv.Exp.Med.Biol., 419, 99-107.
Bell, C.E., & Eisenberg, D. (1996). Crystal structure of diphtheria toxin bound to nicotinamide
adenine dinucleotide. Biochemistry, 35, 1137-1149.
Bernardi, R., Negri, C., Donzelli, M., Guano, F., Torti, M., Prosperi, E., & Scovassi, A.I. (1995).
Activation of poly(ADP-ribose)polymerase in apoptotic human cells. Biochimie, 77,
378-384.
108
Literaturverzeichnis
Birnboim, H.C., & Doly, J. (1979). A rapid alkaline extraction procedure for screening
recombinant plasmid DNA. Nucleic.Acids.Res., 7, 1513-1523.
Blum, H., Beier, H., & Gross, J.H. (1987). Improved silver staining of plant proteins, RNA and
DNA in polyacrylamid gels. Electrophoresis, 8, 93-99.
Blum, P., Ory, J., Bauernfeind, J., & Krska, J. (1992a). Physiological consequences of DnaK
and DnaJ overproduction in Escherichia coli. J.Bacteriol., 174, 7436-7444.
Blum, P., Velligan, M., Lin, N., & Matin, A. (1992b). DnaK-mediated alterations in human
growth hormone protein inclusion bodies. Biotechnology (N.Y.), 10, 301-304.
Boni, I.V., Isaeva, D.M., Musychenko, M.L., & Tzareva, N.V. (1991). Ribosome-messenger
recognition: mRNA target sites for ribosomal protein S1. Nucleic.Acids.Res., 19, 155162.
Borck, K., Beggs, J.D., Brammar, W.J., Hopkins, A.S., & Murray, N.E. (1976). The
construction in vitro of transducing derivatives of phage lambda. Mol.Gen.Genet., 146,
199-207.
Bouet, J.Y., Woszczyk, J., Repoila, F., Francois, V., Louarn, J.M., & Krisch, H.M. (1994).
Direct PCR sequencing of the ndd gene of bacteriophage T4: identification of a product
involved in bacterial nucleoid disruption. Gene, 141, 9-16.
Böhmer, J., Jung, M., Sehr, P., Fritz, G., Popoff, M., Just, I., & Aktories, K. (1996). Active site
mutation of the C3-like ADP-ribosyltransferase from Clostridium limosum--analysis of
glutamic acid 174. Biochemistry, 35, 282-289.
Bradford, M.M. (1976). A rapid and sensitive method for the quantitation of microgram
quantities of protein utilizing the principle of protein-dye binding. Anal.Biochem., 72,
248-254.
Brody, E.N., & Geiduschek, E.P. (1970). Transcription of the bacteriophage T4 template.
Detailed comparison of in vitro and in vivo transcripts. Biochemistry, 9, 1300-1309.
Brody, E.N., Kassavetis, G.A., Ouhammouch, M., Sanders, G.M., Tinker, R.L., & Geiduschek,
E.P. (1995). Old phage, new insights: two recently recognized mechanisms of
transcriptional regulation in bacteriophage T4 development. FEMS Microbiol.Lett., 128,
1-8.
Buchner, J., Schmidt, M., Fuchs, M., Jaenicke, R., Rudolph, R., Schmid, F.X., & Kiefhaber, T.
(1991). GroE facilitates refolding of citrate synthase by suppressing aggregation.
Biochemistry, 30, 1586-1591.
Bullock, W.O., Fernandez, J.M., & Short, J.M. (1987). XL-1 Blue: A high efficency plasmid
transforming recA Escherichia coli strain with β-galactosidase selection. Biotechniques,
5, 376-378.
Burgess, R.R., & Jendrisak, J.J. (1975). A procedure for the rapid, large-scall purification of
Escherichia coli DNA-dependent RNA polymerase involving Polymin P precipitation
and DNA- cellulose chromatography. Biochemistry, 14, 4634-4638.
109
Literaturverzeichnis
Burnette, W.N., Cieplak, W., Mar, V.L., Kaljot, K.T., Sato, H., & Keith, J.M. (1988). Pertussis
toxin S1 mutant with reduced enzyme activity and a conserved protective epitope.
Science, 242, 72-74.
Burnette, W.N., Mar, V.L., Platler, B.W., Schlotterbeck, J.D., McGinley, M.D., Stoney, K.S.,
Rohde, M.F., & Kaslow, H.R. (1991). Site-specific mutagenesis of the catalytic subunit
of cholera toxin: substituting lysine for arginine 7 causes loss of activity. Infect.Immun.,
59, 4266-4270.
Burns, H.D., Ishihama, A., & Minchin, S.D. (1999). Open complex formation during
transcription initiation at the Escherichia coli galP1 promoter: the role of the RNA
polymerase alpha subunit at promoters lacking an UP-element. Nucleic.Acids.Res., 27,
2051-2056.
Carroll, S.F., & Collier, R.J. (1984). NAD binding site of diphtheria toxin: identification of a
residue within the nicotinamide subsite by photochemical modification with NAD.
Proc.Natl.Acad.Sci.U.S.A., 81, 3307-3311.
Carroll, S.F., & Collier, R.J. (1987). Active site of Pseudomonas aeruginosa exotoxin A.
Glutamic acid 553 is photolabeled by NAD and shows functional homology with
glutamic acid 148 of diphtheria toxin. J.Biol.Chem., 262, 8707-8711.
Carroll, S.F., & Collier, R.J. (1988). Amino acid sequence homology between the enzymic
domains of diphtheria toxin and Pseudomonas aeruginosa exotoxin A. Mol.Microbiol.,
2, 293-296.
Chamberlin, M., & Ring, J. (1973). Characterization of T7-specific ribonucleic acid polymerase.
1. General properties of the enzymatic reaction and the template specificity of the
enzyme. J.Biol.Chem., 248, 2235-2244.
Chaudhuri, J.B., Batas, B., & Guise, A.D. (1996). Improving protein refolding yields by
minimizing aggregation. Ann.N.Y.Acad.Sci., 782, 495-505.
Chen, H., Bjerknes, M., Kumar, R., & Jay, E. (1994). Determination of the optimal aligned
spacing between the Shine-Dalgarno sequence and the translation initiation codon of
Escherichia coli mRNAs. Nucleic.Acids.Res., 22, 4953-4957.
Chou, P.Y., & Fasman, G.D. (1978). Prediction of the secondary structure of proteins from their
amino acid sequence. Adv.Enzymol.Relat.Areas.Mol.Biol., 47, 45-148.
Cieplak, W.J., Mead, D.J., Messer, R.J., & Grant, C.C. (1995). Site-directed mutagenic
alteration of potential active-site residues of the A subunit of Escherichia coli heat-labile
enterotoxin. Evidence for a catalytic role for glutamic acid 112. J.Biol.Chem., 270,
30545-30550.
deMurcia JM, Niedergang, C., Trucco, C., Ricoul, M., Dutrillaux, B., Mark, M., Oliver, F.J.,
Masson, M., Dierich, A., LeMeur, M., Walztinger, C., Chambon, P., & deMurcia, G.
(1997). Requirement of poly(ADP-ribose) polymerase in recovery from DNA damage in
mice and in cells. Proc.Natl.Acad.Sci.U.S.A., 94, 7303-7307.
110
Literaturverzeichnis
Depping, R. (1998). ADP-Ribosylierung als ein Mittel der Regulation: Versuch der
biochemischen Charakterisierung von Zielproteinen der Transferase ModB des
Bakteriophagen T4. Diplomarbeit, Fakultät für Biologie, Ruhr-Universität Bochum,
Deutschland,
Dill, K.A., & Shortle, D. (1991). Denatured states of proteins. Annu.Rev.Biochem., 60, 795825.
DiMauro, E., Synder, L., Marino, P., Lamberti, A., Coppo, A., & Tocchini-Valenti, G.P. (1969).
Rifampicin sensitivity of the components of DNA-dependent RNA polymerase. Nature,
222, 533-537.
Domenighini, M., Magagnoli, C., Pizza, M., & Rappuoli, R. (1994). Common features of the
NAD-binding and catalytic site of ADP- ribosylating toxins. Mol.Microbiol., 14, 41-50.
Domenighini, M., & Rappuoli, R. (1996). Three conserved consensus sequences identify the
NAD-binding site of ADP-ribosylating enzymes, expressed by eukaryotes, bacteria and
T-even bacteriophages. Mol.Microbiol., 21, 667-674.
Douglas, C.M., & Collier, R.J. (1987). Exotoxin A of Pseudomonas aeruginosa: substitution of
glutamic acid 553 with aspartic acid drastically reduces toxicity and enzymatic activity.
J.Bacteriol., 169, 4967-4971.
Dubendorff, J.W., & Studier, F.W. (1991). Controlling basal expression in an inducible T7
expression system by blocking the target T7 promoter with lac repressor. J.Mol.Biol.,
219, 45-59.
Dunn, J.J., & Studier, F.W. (1983). Complete nucleotide sequence of bacteriophage T7 DNA
and the locations of T7 genetic elements. J.Mol.Biol., 166, 477-535.
Farzaneh, F., Meldrum, R., & Shall, S. (1987). Transient formation of DNA strand breaks
during the induced differentiation of a human promyelocytic leukaemic cell line, HL-60.
Nucleic.Acids.Res., 15, 3493-3502.
Finck-Barbancon, V., & Barbieri, J.T. (1995). ADP-ribosylation of alpha i3C20 by the S1
subunit and deletion peptides of S1 of pertussis toxin. Biochemistry, 34, 1070-1075.
Flanders, K.C., Horwitz, E.M., & Gurd, R.S. (1984). Semisynthetic derivatives of glucagon. The
contribution of histidine-1 to hormone conformation and activity. J.Biol.Chem., 259,
7031-7037.
Gaal, T., Ross, W., Blatter, E.E., Tang, H., Jia, X., Krishnan, V.V., Assa-Munt, N., Ebright,
R.H., & Gourse, R.L. (1996). DNA-binding determinants of the alpha subunit of RNA
polymerase: novel DNA-binding domain architecture. Genes Dev., 10, 16-26.
Garnier, J., Gibrat, J.F., & Robson, B. (1996). GOR method for predicting protein secondary
structure from amino acid sequence. Methods Enzymol., 266, 540-553.
Garnier, J., Osguthorpe, D.J., & Robson, B. (1978). Analysis of the accuracy and implications of
simple methods for predicting the secondary structure of globular proteins. J.Mol.Biol.,
120, 97-120.
111
Literaturverzeichnis
Giffard, P.M., & Booth, I.R. (1988). The rpoA341 allele of Escherichia coli specifically impairs
the transcription of a group of positively-regulated operons. Mol.Gen.Genet., 214, 148152.
Goff, C.G. (1974). Chemical structure of a modification of the Escherichia coli ribonucleic acid
polymerase alpha polypeptides induced by bacteriophage T4 infection. J.Biol.Chem.,
249, 6181-6190.
Goff, C.G. (1979). Bacteriophage T4 alt gene maps between genes 30 and 54. J.Virol., 29,
1232-1234.
Goff, C.G. (1984). Coliphage-induced ADP-ribosylation of Escherichia coli RNA polymerase.
Methods Enzymol., 106, 418-429.
Goff, C.G., & Setzer, J. (1980). ADP ribosylation of Escherichia coli RNA polymerase is
nonessential for bacteriophage T4 development. J.Virol., 33, 547-549.
Gold, L. (1988). Posttranscriptional regulatory mechanisms in Escherichia coli.
Annu.Rev.Biochem., 57, 199-233.
Goldfarb, A., & Palm, P. (1981). Control of promoter utilization by bacteriophage T4-induced
modification of RNA polymerase alpha subunit. Nucleic Acids Res., 9, 4863-4878.
Golomb, M., & Chamberlin, M. (1974). Characterization of T7-specific ribonucleic acid
polymerase. IV. Resolution of the major in vitro transcripts by gel electrophoresis.
J.Biol.Chem., 249, 2858-2863.
Goloubinoff, P., Gatenby, A.A., & Lorimer, G.H. (1989). GroE heat-shock proteins promote
assembly of foreign prokaryotic ribulose bisphosphate carboxylase oligomers in
Escherichia coli. Nature, 337, 44-47.
Goode, B.L., & Feinstein, S.C. (1992). "Speedprep" purification of template for double-stranded
DNA sequencing. Biotechniques, 12, 374-375.
Grodberg, J., & Dunn, J.J. (1988). ompT encodes the Escherichia coli outer membrane protease
that cleaves T7 RNA polymerase during purification. J.Bacteriol., 170, 1245-1253.
Guild, N., Gayle, M., Sweeney, R., Hollingsworth, T., Modeer, T., & Gold, L. (1988).
Transcriptional activation of bacteriophage T4 middle promoters by the motA protein.
J.Mol.Biol., 199, 241-258.
Guise, A.D., West, S.M., & Chaudhuri, J.B. (1996). Protein folding in vivo and renaturation of
recombinant proteins from inclusion bodies. Mol.Biotechnol., 6, 53-64.
Guzman, L.M., Belin, D., Carson, M.J., & Beckwith, J. (1995). Tight regulation, modulation,
and high-level expression by vectors containing the arabinose PBAD promoter.
J.Bacteriol., 177, 4121-4130.
Hagel, P., Gerding, J.J., Fieggen, W., & Bloemendal, H. (1971). Cyanate formation in solutions
of urea. I. Calculation of cyanate concentrations at different temperature and pH.
Biochim.Biophys.Acta, 243, 366-373.
112
Literaturverzeichnis
Han, X.Y., & Galloway, D.R. (1995). Active site mutations of Pseudomonas aeruginosa
exotoxin A. Analysis of the His440 residue. J.Biol.Chem., 270, 679-684.
Hanahan, D. (1983). Studies on transformation of Escherichia coli with plasmids. J.Mol.Biol.,
166, 557-580.
Harley, C.B., & Reynolds, R.P. (1987). Analysis of E. coli promoter sequences.
Nucleic.Acids.Res., 15, 2343-2361.
Haselkorn, R., Vogel, M., & Brown, R.D. (1969). Conservation of the rifamycin sensitivity of
transcription during T4 development. Nature, 221, 836-838.
Hawley, D.K., & McClure, W.R. (1983). Compilation and analysis of Escherichia coli promoter
DNA sequences. Nucleic.Acids.Res., 11, 2237-2255.
Herendeen, D.R., Kassavetis, G.A., Barry, J., Alberts, B.M., & Geiduschek, E.P. (1989).
Enhancement of bacteriophage T4 late transcription by components of the T4 DNA
replication apparatus. Science, 245, 952-958.
Herendeen, D.R., Williams, K.P., Kassavetis, G.A., & Geiduschek, E.P. (1990). An RNA
polymerase-binding protein that is required for communication between an enhancer and
a promoter. Science, 248, 573-578.
Hinton, D.M. (1989). Transcript analyses of the uvsX-40-41 region of bacteriophage T4.
Changes in the RNA as infection proceeds. J.Biol.Chem., 264, 14432-14439.
Hinton, D.M. (1991). Transcription from a bacteriophage T4 middle promoter using T4 motA
protein and phage-modified RNA polymerase. J.Biol.Chem., 266, 18034-18044.
Hinton, D.M., March-Amegadzie, R., Gerber, J.S., & Sharma, M. (1996). Characterization of
pre-transcription complexes made at a bacteriophage T4 middle promoter: involvement
of the T4 MotA activator and the T4 AsiA protein, a sigma 70 binding protein, in the
formation of the open complex. J.Mol.Biol., 256, 235-248.
Hlavac, F., & Rouer, E. (1997). Expression of the protein-tyrosine kinase p56lck by the pTRX
vector yields a highly soluble protein recovered by mild sonication. Protein Expr.Purif.,
11, 227-232.
Hlodan, R., Craig, S., & Pain, R.H. (1991). Protein folding and its implications for the
production of recombinant proteins. Biotechnol.Genet.Eng.Rev., 9, 47-88.
Holzinger, A., Phillips, K.S., & Weaver, T.E. (1996). Single-step purification/solubilization of
recombinant proteins: application to surfactant protein B. Biotechniques, 20, 804-808.
Honjo, T., Nishizuka, Y., & Hayaishi, O. (1968). Diphtheria toxin-dependent adenosine
diphosphate ribosylation of aminoacyl transferase II and inhibition of protein synthesis.
J.Biol.Chem., 243, 3553-3555.
Hopp, T.P., & Woods, K.R. (1981). Prediction of protein antigenic determinants from amino
acid sequences. Proc.Natl.Acad.Sci.U.S.A., 78, 3824-3828.
113
Literaturverzeichnis
Horvitz, H.R. (1974a). Bacteriophage T4 mutants deficient in alteration and modification of the
Escherichia coli RNA polymerase. J.Mol.Biol., 90, 739-750.
Horvitz, H.R. (1974b). Control by bacteriophage T4 of two sequential phosphorylations of the
alpha subunit of Escherichia coli RNA polymerase. J.Mol.Biol., 90, 727-738.
Hsu, T., & Karam, J.D. (1990). Transcriptional mapping of a DNA replication gene cluster in
bacteriophage T4. Sites for initiation, termination, and mRNA processing. J.Biol.Chem.,
265, 5303-5316.
Igarashi, K., & Ishihama, A. (1991). Bipartite functional map of the E. coli RNA polymerase
alpha subunit: involvement of the C-terminal region in transcription activation by cAMPCRP. Cell, 65, 1015-1022.
Iglewski, B.H., & Kabat, D. (1975). NAD-dependent inhibition of protein synthesis by
Pseudomonas aeruginosa toxin. Proc.Natl.Acad.Sci.U.S.A., 72, 2284-2288.
Iost, I., & Dreyfus, M. (1995). The stability of Escherichia coli lacZ mRNA depends upon the
simultaneity of its synthesis and translation. EMBO J., 14, 3252-3261.
Ishihama, A. (1993). Protein-protein communication within the transcription apparatus.
J.Bacteriol., 175, 2483-2489.
Janknecht, R., de, M.G., Lou, J., Hipskind, R.A., Nordheim, A., & Stunnenberg, H.G. (1991).
Rapid and efficient purification of native histidine-tagged protein expressed by
recombinant vaccinia virus. Proc.Natl.Acad.Sci.U.S.A., 88, 8972-8976.
Jeon, Y.H., Negishi, T., Shirakawa, M., Yamazaki, T., Fujita, N., Ishihama, A., & Kyogoku, Y.
(1995). Solution structure of the activator contact domain of the RNA polymerase alpha
subunit. Science, 270, 1495-1497.
Kainz, M., & Gourse, R.L. (1998). The C-terminal domain of the alpha subunit of Escherichia
coli RNA polymerase is required for efficient rho-dependent transcription termination.
J.Mol.Biol., 284, 1379-1390.
Kaiser, F. (1999). Überexpression und Reinigung der ADP-Ribosyltransferase ModB.
Diplomarbeit, Fakultät für Biologie, Ruhr-Universität Bochum, Deutschland,
Kassavetis, G.A., Zentner, P.G., & Geiduschek, E.P. (1986). Transcription at bacteriophage T4
variant late promoters. An application of a newly devised promoter-mapping method
involving RNA chain retraction. J.Biol.Chem., 261, 14256-14265.
Katada, T., & Ui, M. (1982). ADP ribosylation of the specific membrane protein of C6 cells by
islet- activating protein associated with modification of adenylate cyclase activity.
J.Biol.Chem., 257, 7210-7216.
Khan, R.H., Rao, K.B., Eshwari, A.N., Totey, S.M., & Panda, A.K. (1998). Solubilization of
recombinant ovine growth hormone with retention of native-like secondary structure and
its refolding from the inclusion bodies of Escherichia coli. Biotechnol.Prog., 14, 722728.
114
Literaturverzeichnis
Koch, H. (1999). Charakterisierung der ADP-Ribosyltransferase Alt des Bakteriophagen T4.
Dissertation, Fakultät für Biologie, Ruhr-Universität Bochum, Deutschland.
Koch, T., Raudonikiene, A., Wilkens, K., & Ruger, W. (1995). Overexpression, purification,
and characterization of the ADP- ribosyltransferase (gpAlt) of bacteriophage T4: ADPribosylation of E. coli RNA polymerase modulates T4 "early" transcription. Gene Expr.,
4, 253-264.
Kolb, A., Hermoso, J.M., Thomas, J.O., & Szer, W. (1977). Nucleic acid helix-unwinding
properties of ribosomal protein S1 and the role of S1 in mRNA binding to ribosomes.
Proc.Natl.Acad.Sci.U.S.A., 74, 2379-2383.
Kopetzki, E., Schumacher, G., & Buckel, P. (1989). Control of formation of active soluble or
inactive insoluble baker's yeast alpha-glucosidase PI in Escherichia coli by induction and
growth conditions. Mol.Gen.Genet., 216, 149-155.
Kutter, E., Stidham, T., Guttman, B., Batts, D., Peterson, S., Djavakhishvili, T., Arisaka, F.,
Mesyanzhinov, V., Rueger, W., & Mosig, G. (1994). Genomic map of bacteriophage T4.
In J.D. Karam, J.W. Drake, K.N. Kreuzer, G. Mosig, D.H. Hall, F.A. Eiserling, L.W.
Black, E.K. Spicer, E. Kutter, K. Carlson, & E.S. Miller (Eds.), Molecular biology of
bacteriophage T4. (Seite 491-519). ASM Press, Washington.
Kyte, J., & Doolittle, R.F. (1982). A simple method for displaying the hydropathic character of a
protein. J.Mol.Biol., 157, 105-132.
Laemmli, U.K. (1970). Cleavage of structural proteins during the assembly of the head of
bacteriophage T4. Nature, 227, 680-685.
Langer, T., Lu, C., Echols, H., Flanagan, J., Hayer, M.K., & Hartl, F.U. (1992). Successive
action of DnaK, DnaJ and GroEL along the pathway of chaperone-mediated protein
folding. Nature, 356, 683-689.
Langley, K.E., Berg, T.F., Strickland, T.W., Fenton, D.M., Boone, T.C., & Wypych, J. (1987).
Recombinant-DNA-derived bovine growth hormone from Escherichia coli. 1.
Demonstration that the hormone is expressed in reduced form, and isolation of the
hormone in oxidized, native form. Eur.J.Biochem., 163, 313-321.
LaVallie, E.R., DiBlasio, E.A., Kovacic, S., Grant, K.L., Schendel, P.F., & McCoy, J.M. (1993).
A thioredoxin gene fusion expression system that circumvents inclusion body formation
in the E. coli cytoplasm. Biotechnology (N.Y.), 11, 187-193.
Lee, N. (1980). Molecular aspects of ara regulation. In J.H. Miller & W.S. Reznikoff (Eds.),
The Operon. (Seite 389-410). Cold Spring Harbor, N.Y.: Cold Spring Harbor
Laboratory.
Lee, N., Francklyn, C., & Hamilton, E.P. (1987). Arabinose-induced binding of AraC protein to
araI2 activates the araBAD operon promoter. Proc.Natl.Acad.Sci.U.S.A., 84, 88148818.
115
Literaturverzeichnis
LeGrice SF, & Grüninger-Leitch, F. (1990). Rapid purification of homodimer and heterodimer
HIV-1 reverse transcriptase by metal chelate affinity chromatography. Eur.J.Biochem.,
187, 307-314.
Leonetti, J.P., Wong, K., & Geiduschek, E.P. (1998). Core-sigma interaction: probing the
interaction of the bacteriophage T4 gene 55 promoter recognition protein with E. coli
RNA polymerase core. EMBO J., 17, 1467-1475.
Liebig, H.D., & Rüger, W. (1989). Bacteriophage T4 early promoter regions. Consensus
sequences of promoters and ribosome-binding sites. J.Mol.Biol., 208, 517-536.
Lobet, Y., Cluff, C.W., & Cieplak, W.J. (1991). Effect of site-directed mutagenic alterations on
ADP-ribosyltransferase activity of the A subunit of Escherichia coli heat-labile
enterotoxin. Infect.Immun., 59, 2870-2879.
Lowery, R.G., Saari, L.L., & Ludden, P.W. (1986). Reversible regulation of the nitrogenase iron
protein from Rhodospirillum rubrum by ADP-ribosylation in vitro. J.Bacteriol., 166,
513-518.
Ludden, P.W. (1994). Reversible ADP-ribosylation as a mechanism of enzyme regulation in
procaryotes. Mol.Cell Biochem., 138, 123-129.
Mailhammer, R., Yang, H.L., Reiness, G., & Zubay, G. (1975). Effects of bacteriophage T4induced modification of Escherichia coli RNA polymerase on gene expression in vitro.
Proc.Natl.Acad.Sci.U.S.A., 72, 4928-4932.
Makarova, O.V., Makarov, E.M., Sousa, R., & Dreyfus, M. (1995). Transcribing of Escherichia
coli genes with mutant T7 RNA polymerases: stability of lacZ mRNA inversely
correlates with polymerase speed. Proc.Natl.Acad.Sci.U.S.A., 92, 12250-12254.
Maniatis T., Fritsch E.F., & Sambrook J. (1982). Molecular Cloning, A Laboratory Manual. In
Molecular Cloning, A Laboratory Manual. Cold Spring Harbor Laboratory,New York.
March-Amegadzie, R., & Hinton, D.M. (1995). The bacteriophage T4 middle promoter PuvsX:
analysis of regions important for binding of the T4 transcriptional activator MotA and for
activation of transcription. Mol.Microbiol., 15, 649-660.
Marsischky, G.T., Wilson, B.A., & Collier, R.J. (1995). Role of glutamic acid 988 of human
poly-ADP-ribose polymerase in polymer formation. Evidence for active site similarities
to the ADP- ribosylating toxins. J.Biol.Chem., 270, 3247-3254.
Mekalanos, J.J., Collier, R.J., & Romig, W.R. (1979). Enzymic activity of cholera toxin. I. New
method of assay and the mechanism of ADP-ribosyl transfer. J.Biol.Chem., 254, 58495854.
Miroux, B., & Walker, J.E. (1996). Over-production of proteins in Escherichia coli: mutant
hosts that allow synthesis of some membrane proteins and globular proteins at high
levels. J.Mol.Biol., 260, 289-298.
116
Literaturverzeichnis
Mitraki, A., Betton, J.M., Desmadril, M., & Yon, J.M. (1987). Quasi-irreversibility in the
unfolding-refolding transition of phosphoglycerate kinase induced by guanidine
hydrochloride. Eur.J.Biochem., 163, 29-34.
Mitraki, A., & King, J. (1989). Protein folding intermediates and inclusion body formation.
BIO/TECHNOLOGY, 7, 690-697.
Moffatt, B.A., & Studier, F.W. (1987). T7 lysozyme inhibits transcription by T7 RNA
polymerase. Cell, 49, 221-227.
Moore, J.T., Uppal, A., Maley, F., & Maley, G.F. (1993). Overcoming inclusion body formation
in a high-level expression system. Protein Expr.Purif., 4, 160-163.
Mosig, G., Colowick, N.E., & Pietz, B.C. (1998). Several new bacteriophage T4 genes, mapped
by sequencing deletion endpoints between genes 56 (dCTPase) and dda (a DNAdependent ATPase- helicase) modulate transcription. Gene, 223, 143-155.
Mosig, G., & Hall, D.H. (1994). Gene expression: A paradigm of integrated circuits. In J.D.
Karam, J.W. Drake, K.N. Kreuzer, G. Mosig, D.H. Hall, F.A. Eiserling, L.W. Black, E.K.
Spicer, E. Kutter, K. Carlson, & E.S. Miller (Eds.), Molecular biology of bacteriophage
T4. (Seite 127-208). ASM Press, Washington D.C.
Moss, J., Manganiello, V.C., & Vaughan, M. (1976). Hydrolysis of nicotinamide adenine
dinucleotide by choleragen and its A protomer: possible role in the activation of
adenylate cyclase. Proc.Natl.Acad.Sci.U.S.A., 73, 4424-4427.
Moss, J., & Richardson, S.H. (1978). Activation of adenylate cyclase by heat-labile Escherichia
coli enterotoxin. Evidence for ADP-ribosyltransferase activity similar to that of
choleragen. J.Clin.Invest., 62, 281-285.
Moss, J., Stanley, S.J., & Oppenheimer, N.J. (1979). Substrate specificity and partial
purification of a stereospecific NAD- and guanidine-dependent ADP-ribosyltransferase
from avian erythrocytes. J.Biol.Chem., 254, 8891-8894.
Moss, J., & Vaughan, M. (1977). Mechanism of action of choleragen. Evidence for ADPribosyltransferase activity with arginine as an acceptor. J.Biol.Chem., 252, 2455-2457.
Moss, J., & Vaughan, M. (1978). Isolation of an avian erythrocyte protein possessing ADPribosyltransferase activity and capable of activating adenylate cyclase.
Proc.Natl.Acad.Sci.U.S.A., 75, 3621-3624.
Nesterenko, M.V., Tilley, M., & Upton, S.J. (1994). A simple modification of Blum's silver
stain method allows for 30 minute detection of proteins in polyacrylamide gels.
J.Biochem.Biophys.Methods, 28, 239-242.
Nossal, N.G. (1994). The bacteriophage T4 DNA replication fork. In J.D. Karam, J.W. Drake,
K.N. Kreuzer, G. Mosig, D.H. Hall, F.A. Eiserling, L.W. Black, E.K. Spicer, E. Kutter,
K. Carlson, & E.S. Miller (Eds.), Molecular biology of bacteriophage T4. (Seite 43-53).
ASM Press, Washington D.C.
117
Literaturverzeichnis
Oberg, K., Chrunyk, B.A., Wetzel, R., & Fink, A.L. (1994). Nativelike secondary structure in
interleukin-1 beta inclusion bodies by attenuated total reflectance FTIR. Biochemistry,
33, 2628-2634.
Okazaki, I.J., & Moss, J. (1996). Structure and function of eukaryotic mono-ADPribosyltransferases. Rev.Physiol.Biochem.Pharmacol., 129, 51-104.
Ouhammouch, M., Adelman, K., Harvey, S.R., Orsini, G., & Brody, E.N. (1995). Bacteriophage
T4 MotA and AsiA proteins suffice to direct Escherichia coli RNA polymerase to initiate
transcription at T4 middle promoters. Proc.Natl.Acad.Sci.U.S.A., 92, 1451-1455.
Ouhammouch, M., Orsini, G., & Brody, E.N. (1994). The asiA gene product of bacteriophage
T4 is required for middle mode RNA synthesis. J.Bacteriol., 176, 3956-3965.
Ovchinnikov, Y.A., Lipkin, V.M., Modyanov, N.N., Chertov, O.Y., & Smirnov, Y.V. (1977).
Primary structure of alpha-subunit of DNA-dependent RNA polymerase from
Escherichia coli. FEBS Lett., 76, 108-111.
Papini, E., Schiavo, G., Sandona, D., Rappuoli, R., & Montecucco, C. (1989). Histidine 21 is at
the NAD+ binding site of diphtheria toxin. J.Biol.Chem., 264, 12385-12388.
Passador, L., & Iglewski, W. (1994). ADP-ribosylating toxins. Meth.Enzymol., 235, 617-631.
Perelle, S., Domenighini, M., & Popoff, M.R. (1996). Evidence that Arg-295, Glu-378, and Glu380 are active-site residues of the ADP-ribosyltransferase activity of iota toxin. FEBS
Lett., 395, 191-194.
Pizza, M., Bartoloni, A., Prugnola, A., Silvestri, S., & Rappuoli, R. (1988). Subunit S1 of
pertussis toxin: mapping of the regions essential for ADP- ribosyltransferase activity.
Proc.Natl.Acad.Sci.U.S.A., 85, 7521-7525.
Pope, M.R., Murrell, S.A., & Ludden, P.W. (1985). Covalent modification of the iron protein of
nitrogenase from Rhodospirillum rubrum by adenosine diphosphoribosylation of a
specific arginine residue. Proc.Natl.Acad.Sci.U.S.A., 82, 3173-3177.
Porath, J. (1992). Immobilized metal ion affinity chromatography. Protein Expr.Purif., 3, 263281.
Porath, J., Carlsson, J., Olsson, I., & Belfrage, G. (1975). Metal chelate affinity
chromatography, a new approach to protein fractionation. Nature, 258, 598-599.
Przybycien, T.M., Dunn, J.P., Valax, P., & Georgiou, G. (1994). Secondary structure
characterization of beta-lactamase inclusion bodies. Protein Eng., 7, 131-136.
Rabussay, D., & Geiduschek, E.P. (1977a). Regulation of gene action in the development of
lytic bacteriophages. In H. Fraenkel-Conrat & R.R. Wagner (Eds.), Comprehensive
virology. (Seite 1-196). New York and London: Plenum Press.
Rabussay, D., & Geiduschek, E.P. (1977b). Phage T4-modified RNA polymerase transcribes T4
late genes in vitro. Proc.Natl.Acad.Sci.U.S.A., 74, 5305-5309.
118
Literaturverzeichnis
Realini, C.A., & Althaus, F.R. (1992). Histone shuttling by poly(ADP-ribosylation).
J.Biol.Chem., 267, 18858-18865.
Ringquist, S., Shinedling, S., Barrick, D., Green, L., Binkley, J., Stormo, G.D., & Gold, L.
(1992). Translation initiation in Escherichia coli: sequences within the ribosome-binding
site. Mol.Microbiol., 6, 1219-1229.
Robertson, E.S., & Nicholson, A.W. (1992). Phosphorylation of Escherichia coli translation
initiation factors by the bacteriophage T7 protein kinase. Biochemistry, 31, 4822-4827.
Rohrer, H., Zillig, W., & Mailhammer, R. (1975). ADP-ribosylation of DNA-dependent RNA
polymerase of Escherichia coli by an NAD+: protein ADP-ribosyltransferase from
bacteriophage T4. Eur.J.Biochem., 60, 227-238.
Rosenberg, A.H., Lade, B.N., Chui, D.S., Lin, S.W., Dunn, J.J., & Studier, F.W. (1987). Vectors
for selective expression of cloned DNAs by T7 RNA polymerase. Gene, 56, 125-135.
Ross, W., Aiyar, S.E., Salomon, J., & Gourse, R.L. (1998). Escherichia coli promoters with UP
elements of different strengths: modular structure of bacterial promoters. J.Bacteriol.,
180, 5375-5383.
Ross, W., Gosink, K.K., Salomon, J., Igarashi, K., Zou, C., Ishihama, A., Severinov, K., &
Gourse, R.L. (1993). A third recognition element in bacterial promoters: DNA binding
by the alpha subunit of RNA polymerase. Science, 262, 1407-1413.
Rossmann, M.G., Liljas, A., & Branden, C.J.B.L.J. (1975). Evolutionary and structural
relationship among dehydrogenases. In P.D. Boyer (Ed.), The Enzymes. (Seite 61-102).
New York: Academic Press.
Sanger, F., Nicklen, S., & Coulson, A.R. (1977). DNA sequencing with chain-terminating
inhibitors. Proc.Natl.Acad.Sci.U.S.A., 74, 5463-5467.
Sanson, B., & Uzan, M. (1993). Dual role of the sequence-specific bacteriophage T4
endoribonuclease RegB. mRNA inactivation and mRNA destabilization. J.Mol.Biol.,
233, 429-446.
Satoh, M.S., Poirier, G.G., & Lindahl, T. (1994). Dual function for poly(ADP-ribose) synthesis
in response to DNA strand breakage. Biochemistry, 33, 7099-7106.
Schein, C.H. (1989). Production of soluble recombinant proteins in bacteria.
BIO/TECHNOLOGY, 7, 1141-1149.
Schein, C.H. (1990). Solubility as a function of protein structure and solvent components.
BIO/TECHNOLOGY, 8, 308-317.
Schein, C.H. (1991). Optimizing protein folding to the native state in bacteria.
Curr.Opin.Biotechnol., 2, 746-750.
Schein, C.H., & Noteborn, M. (1988). Formation of soluble recombinant proteins in Escherichia
coli is favored by lower growth temperature. BIO/TECHNOLOGY, 6, 291-294.
119
Literaturverzeichnis
Schmidt, R.P., & Kreuzer, K.N. (1992). Purified MotA protein binds the -30 region of a
bacteriophage T4 middle- mode promoter and activates transcription in vitro.
J.Biol.Chem., 267, 11399-11407.
Seifert, W., Qasba, P., Walter, G., Palm, P., Schachner, M., & Zillig, W. (1969). Kinetics of the
alteration and modification of DNA-dependent RNA- polymerase in T4-infected E. coli
cells. Eur.J.Biochem., 9, 319-324.
Shall, S. (1995). ADP-ribosylation reactions. Biochimie, 77, 313-318.
Shi, P.Y., Maizels, N., & Weiner, A.M. (1997). Recovery of soluble, active recombinant protein
from inclusion bodies. Biotechniques, 23, 1036-1038.
Shigesada, K., & Imai, M. (1982). Function of transcription termination factor rho in a model
transcription system using synthetic deoxyribonucleic acid as template. Biochemistry,
21, 5849-5856.
Short, J.M., Fernandez, J.M., Sorge, J.A., & Huse, W.D. (1988). Lambda ZAP: a bacteriophage
lambda expression vector with in vivo excision properties. Nucleic.Acids.Res., 16, 75837600.
Skorko, R., & Kur, J. (1981). ADP-ribosylation of proteins in non-infected Escherichia coli
cells. Eur.J.Biochem., 116, 317-322.
Skorko, R., Zillig, W., Rohrer, H., Fujiki, H., & Mailhammer, R. (1977). Purification and
properties of the NAD+: protein ADP- ribosyltransferase responsible for the T4-phageinduced modification of the alpha subunit of DNA-dependent RNA polymerase of
Escherichia coli. Eur.J.Biochem., 79, 55-66.
Smith, D.B., & Johnson, K.S. (1988). Single-step purification of polypeptides expressed in
Escherichia coli as fusions with glutathione S-transferase. Gene, 67, 31-40.
Soman, G., Miller, J.F., & Graves, D.J. (1984). Use of guanylhydrazones as substrates for
guanidine-specific mono-ADP- ribosyltransferases. Methods Enzymol., 106, 403-410.
Soman, G., Tomer, K.B., & Graves, D.J. (1983). Assay of mono ADP-ribosyltransferase activity
by using guanylhydrazones. Anal.Biochem., 134, 101-110.
Sprengart, M.L., Fuchs, E., & Porter, A.G. (1996). The downstream box: an efficient and
independent translation initiation signal in Escherichia coli. EMBO J., 15, 665-674.
Stitt, B., & Hinton, D.M. (1994). Regulation of middle-mode transcription. In J.D. Karam, J.W.
Drake, K.N. Kreuzer, G. Mosig, D.H. Hall, F.A. Eiserling, L.W. Black, E.K. Spicer, E.
Kutter, K. Carlson, & E.S. Miller (Eds.), Molecular biology of bacteriophage T4. (Seite
142-160). ASM Press, Washington D.C.
Strandberg, L., & Enfors, S.O. (1991). Factors influencing inclusion body formation in the
production of a fused protein in Escherichia coli. Appl.Environ.Microbiol., 57, 16691674.
120
Literaturverzeichnis
Streisinger, G., Edgar, R.S., & Denhardt, G.H. (1964). Chromosome structure in phage T4. I.
Circularity of the linkage map. Proc.Natl.Acad.Sci.U.S.A., 51, 775-779.
Streisinger, G., Emrich, J., & Stahl, M.M. (1967). Chromosome structure in phage T4. III.
Terminal redundancy and length determination. Proc.Natl.Acad.Sci.U.S.A., 57, 292-295.
Strzelecka-Golaszewska, H., Venyaminov, S.Y., Zmorzynski, S., & Mossakowska, M. (1985).
Effects of various amino acid replacements on the conformational stability of G-actin.
Eur.J.Biochem., 147, 331-342.
Studier, F.W. (1991). Use of bacteriophage T7 lysozyme to improve an inducible T7 expression
system. J.Mol.Biol., 219, 37-44.
Studier, F.W., & Moffatt, B.A. (1986). Use of bacteriophage T7 RNA polymerase to direct
selective high- level expression of cloned genes. J Mol Biol, 189, 113-130.
Studier, F.W., Rosenberg, A.H., Dunn, J.J., & Dubendorff, J.W. (1990). Use of T7 RNA
polymerase to direct expression of cloned genes. Meth.Enzymol., 185, 60-89.
Tabor, S., & Richardson, C.C. (1985). A bacteriophage T7 RNA polymerase/promoter system
for controlled exclusive expression of specific genes. Proc.Natl.Acad.Sci.U.S.A., 82,
1074-1078.
Takada, T., Iida, K., & Moss, J. (1995). Conservation of a common motif in enzymes catalyzing
ADP-ribose transfer. Identification of domains in mammalian transferases. J.Biol.Chem.,
270, 541-544.
Takahashi, H., Shimizu, M., Saito, H., & Ikeda, Y. (1979). Studies of viable T4 bacteriophage
containing cytosine-substituted DNA (T4dC phage). II. Cleavage of T4dC DNA by
endonuclease SalI and BamHI. Mol.Gen.Genet., 168, 49-53.
Tang, H., Severinov, K., Goldfarb, A., Fenyo, D., Chait, B., & Ebright, R.H. (1994). Location,
structure, and function of the target of a transcriptional activator protein. Genes Dev., 8,
3058-3067.
Tinker, R.L., Sanders, G.M., Severinov, K., Kassavetis, G.A., & Geiduschek, E.P. (1995). The
COOH-terminal domain of the RNA polymerase alpha subunit in transcriptional
enhancement and deactivation at the bacteriophage T4 late promoter. J.Biol.Chem., 270,
15899-15907.
Tinker, R.L., Williams, K.P., Kassavetis, G.A., & Geiduschek, E.P. (1994). Transcriptional
activation by a DNA-tracking protein: structural consequences of enhancement at the T4
late promoter. Cell, 77, 225-237.
Tomaschewski, J. (1988). Endonuklease VII des Bakteriophagen T4: Sequenzierung und
Überexpression. Dissertation, Fakultät für Biologie, Ruhr-Universität Bochum,
Deutschland.
Towbin, H., Staehelin, T., & Gordon, J. (1979). Electrophoretic transfer of proteins from
polyacrylamid gels to nitrocellulose sheets: procedure and some applications.
Proc.Natl.Acad.Sci.U.S.A., 76, 4350-4354.
121
Literaturverzeichnis
Tsuji, T., Inoue, T., Miyama, A., & Noda, M. (1991). Glutamic acid-112 of the A subunit of
heat-labile enterotoxin from enterotoxigenic Escherichia coli is important for ADPribosyltransferase activity. FEBS Lett., 291, 319-321.
Tweten, R.K., Barbieri, J.T., & Collier, R.J. (1985). Diphtheria toxin. Effect of substituting
aspartic acid for glutamic acid 148 on ADP-ribosyltransferase activity. J.Biol.Chem.,
260, 10392-10394.
Tzareva, N.V., Makhno, V.I., & Boni, I.V. (1994). Ribosome-messenger recognition in the
absence of the Shine-Dalgarno interactions. FEBS Lett., 337, 189-194.
Uchida, T., Gill, D.M., & Pappenheimer, A.M.J. (1971). Mutation in the structural gene for
diphtheria toxin carried by temperate phage . Nat.New Biol., 233, 8-11.
van der Wal FJ, Luirink, J., & Oudega, B. (1995). Bacteriocin release proteins: mode of action,
structure, and biotechnological application. FEMS Microbiol.Rev., 17, 381-399.
Waldor, M.K., & Mekalanos, J.J. (1996). Lysogenic conversion by a filamentous phage
encoding cholera toxin [see comments]. Science, 272, 1910-1914.
Wang, J., Nemoto, E., Kots, A.Y., Kaslow, H.R., & Dennert, G. (1994). Regulation of cytotoxic
T cells by ecto-nicotinamide adenine dinucleotide (NAD) correlates with cell surface
GPI-anchored/arginine ADP-ribosyltransferase. J.Immunol., 153, 4048-4058.
Werner, M.H., Clore, G.M., Gronenborn, A.M., Kondoh, A., & Fisher, R.J. (1994). Refolding
proteins by gel filtration chromatography. FEBS Lett., 345, 125-130.
Wilkens, K., & Rüger, W. (1994). Transcription from early promotors. In J.D. Karam, J.W.
Drake, K.N. Kreuzer, G. Mosig, D.H. Hall, F.A. Eiserling, L.W. Black, E.K. Spicer, E.
Kutter, K. Carlson, & E.S. Miller (Eds.), Molecular biology of bacteriophage T4. (Seite
132-141). ASM Press, Washington D.C.
Wilkens, K., & Rüger, W. (1996). Characterization of bacteriophage T4 early promoters in vivo
with a new promoter probe vector. Plasmid, 35, 108-120.
Wilkens, K., Tiemann, B., Bazan, F., & Rüger, W. (1997). ADP-ribosylation and early
transcription regulation by bacteriophage T4. Adv.Exp.Med.Biol., 419, 71-82.
Wilkinson, D.L., & Harrison, R.G. (1991). Predicting the solubility of recombinant proteins in
Escherichia coli. BIO/TECHNOLOGY, 9, 443-448.
Williams, K.P., Kassavetis, G.A., Herendeen, D.R., & Geiduschek, E.P. (1994). Regulation of
late-gene expression. In J.D. Karam, J.W. Drake, K.N. Kreuzer, G. Mosig, D.H. Hall,
F.A. Eiserling, L.W. Black, E.K. Spicer, E. Kutter, K. Carlson, & E.S. Miller (Eds.),
Molecular biology of bacteriophage T4. (Seite 161-175). ASM Press, Washington D.C.
Wilson, B.A., Reich, K.A., Weinstein, B.R., & Collier, R.J. (1990). Active-site mutations of
diphtheria toxin: effects of replacing glutamic acid-148 with aspartic acid, glutamine, or
serine. Biochemistry, 29, 8643-8651.
122
Literaturverzeichnis
Woodcock, D.M., Crowther, P.J., Doherty, J., Jefferson, S., DeCruz, E., Noyer-Weidner, M.,
Smith, S.S., Michael, M.Z., & Graham, M.W. (1989). Quantitative evaluation of
Escherichia coli host strains for tolerance to cytosine methylation in plasmid and phage
recombinants. Nucleic.Acids.Res., 17, 3469-3478.
Wyatt, G.R., & Cohen, S.S. (1952). A new pyrimidine base from bacteriophage T4. Nature,
170, 1072-1073.
Yanisch-Perron, C., Vieira, J., & Messing, J. (1985). Improved M13 phage cloning vectors and
host strains: nucleotide sequences of the M13mp18 and pUC19 vectors. Gene, 33, 103119.
Yasukawa, T., Kanei-Ishii, C., Maekawa, T., Fujimoto, J., Yamamoto, T., & Ishii, S. (1995).
Increase of solubility of foreign proteins in Escherichia coli by coproduction of the
bacterial thioredoxin. J.Biol.Chem., 270, 25328-25331.
Young, M.C., Reddy, M.K., Jarvis, T.C., Gogol, E.P., Dolejsi, M.K., & von Hippel, P.H. (1994).
Protein-protein and protein-DNA interactions in the T4 DNA polymerase accessory
protein complex. In J.D. Karam, J.W. Drake, K.N. Kreuzer, G. Mosig, D.H. Hall, F.A.
Eiserling, L.W. Black, E.K. Spicer, E. Kutter, K. Carlson, & E.S. Miller (Eds.),
Molecular biology of bacteriophage T4. (Seite 313-321). ASM Press, Washington D.C.
Zhang, X., & Studier, F.W. (1997). Mechanism of inhibition of bacteriophage T7 RNA
polymerase by T7 lysozyme. J.Mol.Biol., 269, 10-27.
Zillig, W., Mailhammer, R., Skorko, R., & Rohrer, H. (1977). Covalent structural modification
of DNA-dependent RNA polymerase as a means for transcriptional control.
Curr.Top.Cell Regul., 12, 263-271.
Zou, C., Fujita, N., Igarashi, K., & Ishihama, A. (1992). Mapping the cAMP receptor protein
contact site on the alpha subunit of Escherichia coli RNA polymerase. Mol.Microbiol.,
6, 2599-2605.
123
Lebenslauf
Lebenslauf:
Persönliche Daten:
Bernd Tiemann
Hermannstraße 1A
58239 Schwerte
geboren am 19. Januar 1965 in Dortmund
ledig
Schulbildung:
08/71 – 08/75
Grundschule in Dormund-Aplerbeck
08/85 – 08/81
Realschule am Bohlgarten in Schwerte
08/81 – 08/84
Ruhrtal Gymnasium in Schwerte
Berufsausbildung, Berufstätigkeit:
10/84 – 07/85
Auslieferfahrer und Hilfskraft im Dental-Labor Otto Kozmacs
GmbH & Co KG in Dortmund-Aplerbeck
08/85 – 07/88
Ausbildung zum Zahntechniker im Dental-Labor Otto Kozmacs
GmbH & Co KG in Dormund-Aplerbeck
07/88 – 09/89
Geselle im Dental-Labor Otto Kozmacs GmbH & Co KG
10/89 – 11/89
Geselle bei Hartmann-Dental GmbH in Datteln
12/89 – 10/90
Geselle im Dental-Labor Otto Kozmacs GmbH & Co KG
Hochschulausbildung:
10/90 – 11/95
Studium der Biologie an der Ruhr-Universität Bochum,
Diplomarbeit: Untersuchungen zur Molekularbiologie
pflanzlicher Nitrilasen
seit 04/96
wissenschaftlicher Mitarbeiter am Lehrstuhl für Biologie der
Mikroorganismen der Ruhr-Universität Bochum und Promotion
Veröffentlichungen:
Hillebrand, H.; Tiemann, B.; Hell, R.; Bartling, D. und Weiler,
E.W. (1996). Structure of the gene encoding nitrilase 1 from
arabidopsis thaliana. Gene 170, 197-200
124
Lebenslauf
Wilkens, K.; Tiemann, B.; Bazan, F. und Rüger W. (1997).
ADP-ribosylation and early transcription regulation by
bacteriophage T4. Adv.Exp.Med.Biol. 419, 71-82
Tiemann, B.; Depping, R. und Rüger W. (1999).
Overexpression, purification, and partial characterization of
ADP-ribosyltransferases ModA and ModB of bacteriophage
T4. Gene Expression (zur Publikation angenommen)
125
Herunterladen
Explore flashcards