Die Materie: Proteine/Bio

Werbung
Bioinformatik
Was Wieso Warum
Esther Ratsch
10. Oktober 2003
Was ist Bioinformatik?
• Anwendung von Methoden der Informatik
auf biologische Probleme
• Speicherung großer Datenmengen
• Kombination großer Datenmengen auf der
Suche nach neuem Wissen
• Unterstützt Laborbiologie an deren Grenzen
• Planung von Experimenten
Was ist Bioinformatik?
•
•
•
•
•
Verschiedene Arten der Bioinformatik, z.B.:
Sequenzanalyse
Modellierung von Proteinstrukturen
Simulation von Netzwerken
Erstellung von Datenbanken
Genom und Gene
gacaaggtga
ttcagcaggc
caggaatttt
tggatgctta
atgagataga
aaaaatgaag
taccgaaagt
tattagtgtt
tatgggcaat
agaaaaaagt
gcatactcgt
tcatttccaa
tcacacacag
aatccctgga
aggtggtctg
caacagtggg
aaccccatct
cccagctact
gtgagccgag
aaaaaaaaaa
atgggacatg
ctgattcagt
tttctcaagc
cctcccaact
ctaaccacaa
ggaggaggag
gatagaggaa
cccaacggtc
cattgggtgg
ttgggtcatc
ttccctgcaa
ataaacagtg
ccggtatagg
gctgggacag
gtggatcact
ctactaaaaa
ctaaggaaat
ccagctactc
aacagagcaa
tggccctcct
caggggacag
catttgacta
acttcttgcc
tcctagtact
attagttaat
taaacctgta
agatggtaaa
tacatatagg
tattttcctt
acccacaatc
gttctcaaac
aagcctctaa
caagtcactg
cacactggga
ggcatagaag
tggatcagga
ctactaaaaa
tgggaggctg
attgcaccac
aaaaagagtg
ggaggcatgg
caaaagtcgt
aagaaatatc
gcactgatcc
ccagttctgc
tttggagaca
gttatcttgg
tccagccaga
ctgttggatg
tttactccag
ttccttgggc
taaccagaat
cacacaatgg
gctgggccat
tgaggtcagg
tacaaaaatt
aattgatgat
gggaggctga
gataaccgtc
tcctgcccct
gtgctctcat gcatggctga
tcaatattaa aaagccctaa
taaggaaata attgacgatg
acttataata atgaaaatca
aaatcatata aaatagttat
tttattgaca cagggagatg
acaatattta aagttcttct
atatcaaatt cttaaatgag
cctagtgttt atttatgtga
tcaccttgat gatgagtaat
ttttcatcag tgaaaattat
aattctagag cctgattcac
gcagggcaaa agcttggttc
agatattctg ggtgttgctg
acaagagtgg gccgggcgcg
ggaggtcagg agtttgagac
tacaaaatat tagccgggca
aggcaggaga attgcttgaa
tgtactccac tccgccaaca
ggtggcggga aggtggctga
ttggcacgag ctcagcctga
agtacttttc ctgctgagat
ctcttctgtt tcagaattat
tgtcccagag aggccctggg
tctctcctgg ttcctgaaat
gccctctacc agaagccaag
tcctgcgccc acagtcccca
tttcctgtcc ccttagcccc
caggttactg ttggagtggg
gtctcccttt catcctcctg
taccagttcc tgacttttgt
ttcagagggg ttagttgtgt
tgagctgaga aatcttgggc
ggctcatgcc tgtaatccca
agttcaagac cagcctggcc
agcttcttgc ctaaggaaaa
gtggctagag gctagggcgt
ggcagaagaa tcgcttgaac
tcaaaaaaaa aaaaaaaaaa
tcccc........
tgggaggatg
aacacgcata
tggcgagaga
gaaacaactc
atgaaatatt
ctcagactaa
tatcaatata
gtattggtga
agacaatgat
tttgatttat
attacttaaa
aaagagccac
cccttctcag
tcccttgtcc
gtggctcacg
cagcctggcc
tggtggcggg
cccaggaggc
gtgagagccc
aggtaggagg
ccagggccca
tggtggccct
tctgaatcat
ctgcatcacc
ccaggagcag
aagaaagggg
gggtcctcct
accaagaacc
ggatggccac
tcttccctgg
tcctttcaaa
gtatcccctg
tggtagtgct
gcactttgga
aacatggtga
atacaaaaat
ggtggcgggc
cattgcacat
aaaaaggctg
aggtaaaatc
cccaaatacg
tttaactcca
taagtatcta
atacagacat
aattgttaag
taaaaatata
gtggtgggat
aaaccttgaa
ttttattttt
ggatgaaaaa
tcgaccaact
caggggacag
cttggccaag
cctgtaatcc
aacatgttga
cgcctgtaat
agaggttgca
tgtctcaaaa
gggaacctaa
gagaggtaga
tttgctgggc
taacccaagt
taactgatca
atggtggtgg
agtgaggagg
tcctgtgaag
agaggctgcc
ctgaggccaa
gggcactcta
ggaaccctgg
gggacaagca
aaattcaaag
ggctgaggca
aaccctgtat
tacttcttgc
acctgtaatc
cagcctgggc
gggacaatgc
Teil der Sequenz des Gens für die leichte und schwere Kette der
menschlichen Myeloperoxidase; EMBL AC X15377
60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
1020
1080
1140
1200
1260
1320
1380
1440
1500
1560
1620
1680
1740
1800
1860
1920
1980
2040
2100
2160
2220
2280
2340
•Genom: Bauplan des
Organismus
•DNA: 4 Nukleotide (A,C,T
und G)
•Unterteilt in Gene, die für
Proteine kodieren
•Genomprojekte:
-Viele Buchstaben
- Wenig Sinn
Vom Gen zum Protein
• Transkription: DNA  RNA
• Translation: RNA  Protein
• Protein: aufgebaut aus Aminosäuren (20)
Sequenzanalyse
• Wo sind Gene in dem BuchstabenHaufen?
• Ähnlichkeitssuchen zur
Vorhersage der
Verwandtschaftsbeziehungen
eines Proteins und damit seiner
Funktion
MFKPVDFSETSPVPPDIDLAPTQSPHHVAPSQDSSYDLLS…………..
………. SMLKNKSFLLHGKDYPNNADNNDNEDIRAKTMNRSQSHV
gatccagctg taccattatg taatataata agacacggac gcac……...
Proteine
MFKPVDFSETSPVPPDIDLAPTQSPHHVAPSQDSSYDLLS…………..
………. SMLKNKSFLLHGKDYPNNADNNDNEDIRAKTMNRSQSHV
gatccagctg taccattatg taatataata agacacggac gcac……...
Struktur-Modellierung
• 3-dimensionale Struktur
bestimmt die Funktion
• Experimentelle Strukturaufklärung zeitaufwändig
(damit teuer) und teilweise
sehr schwer bis garnicht
durchführbar.
• Struktur ist durch Sequenz
festgelegt und kann daher
(näherungsweise)
vorhergesagt werden.
• Vorhersage basierend auf
physikalischen Kräften oder
Ähnlichkeitsanalysen.
Reaktionen und Stoffwechselwege
MFKPVDFSETSPVPPDIDLAPTQSPHHVAPSQDSSYDLLS…………..
………. SMLKNKSFLLHGKDYPNNADNNDNEDIRAKTMNRSQSHV
gatccagctg taccattatg taatataata agacacggac gcac……...
Enzyme
• Enzyme sind Bio-Katalysatoren
(Reaktionsbeschleuniger)
• Sie binden die Reaktanden und vereinfachen damit
deren Interaktion, d.h. die Reaktion zwischen
ihnen
• Klassifizierung: EC-Nummer,
z.B 2.7.1.40:
–2 Transferases
–2.7 Transfering phosphorus
containing group
–2.7.1 Phosphotransferases with an
alcohol group as acceptor
–2.7.1.40 Pyruvate kinase
Pyruvate kinase complex with bis mg-atp-na-oxalate; Pfam
Biochemische Netzwerke
Simulationen
• Das Gesamtheitnetzwerk ist sehr komplex
und kann nicht intuitiv erfaßt werden.
• Einfluß einzelner Vorgänge auf das
Gesamtergebnis vorhersagen
• Testen von Modellen/Hypothesen
• Mathematische Beschreibung der Prozesse
nötig
Beispiel einer Simulation
Experimentell bestimmte (oben)
und simulierte (unten) CalciumKonzentration in Leberzellen.
Datenbanken
• Große Datenmengen
• Speicherung so, daß Daten weiter nutzbar
• Unterscheidung nach Inhalt
(Proteinstrukturen, Reaktionen, Sequenzen)
und Speicherformat (Tabelle, einfacher
Text)
• Unterstützen alle anderen Felder als
Datenquelle und durch Speicherung der
entstandenen Daten
Ein Beispiel - Peroxidasen
• Große Gruppe von Enzymen
• Katalysieren viele verschiedene Reaktionen
• Vorkommen in Pflanzen, Tieren, Pilzen und
Bakterien
• Abwehr von Krankheitserregern (bei Tieren
und Pflanzen)
Tagesablauf
• Suche nach Daten zu Peroxidasen und ihren
Reaktionen in verschiedenen Datenbanken
• Nutzung ähnlicher Daten zur Simulation
einer der katalysierten Reaktionen
• Modellierung der Struktur der zugehörigen
Peroxidase
• Verbesserung der Simulation durch Daten,
die bei der Modellierung des Proteins
gewonnen werden
Herunterladen
Random flashcards
Medizin

5 Karten Sophia Gunkel

lernen

2 Karten oauth2_google_6c83f364-3e0e-4aa6-949b-029a07d782fb

Literaturepochen

2 Karten oauth2_google_55780ed8-d9a3-433e-81ef-5cfc413e35b4

Erstellen Lernkarten