Zur Genetik des Morbus Parkinson - Ruhr
Werbung
Aus der Abteilung für Humangenetik der Ruhr-Universität Bochum Direktor: Prof. Dr. med. J. T. Epplen Zur Genetik des Morbus Parkinson - Analyse der Gene Parkin, PINK1 und LRRK2 - Kumulative Inaugural-Dissertation zur Erlangung des Doktorgrades der Medizin einer Hohen Medizinischen Fakultät der Ruhr-Universität Bochum vorgelegt von Anna Melissa Schlitter aus Herdecke 2006 Dekan: Prof. Dr. med. G. Muhr Referent: Prof. Dr. med. J. T. Epplen Koreferent: Prof. Dr. med. T. Müller Tag der mündlichen Prüfung: 12.06.2007 Abkürzungsverzeichnis Abkürzungsverzeichnis AD Autosomal-dominant AR Autosomal-rezessiv AS Aminosäure ATP Adenosin-5′-triphosphat COR C-terminal domain of Roc Da Dalton; 1Da=1.66•10-24g DHPLC denaturating high performance liquid chromatography et al. und andere (et alii) IBR In-Between-RING-Finger Domäne k Kilo (103) LBs Lewy bodies LRR Leucine-rich repeat LRRK2 Leucine-rich repeat Kinase 2 MA Morbus Alzheimer MPKKK mitogen activated Protein Kinase Kinase Kinase MP Morbus Parkinson MPTP 1-Methyl-4-Phenyl-1,2,3,6-Tetrahydropyridin p kurzer Arm eines Chromosoms PCR polymerase chain reaction, Polymeraseketten-Reaktion PET Positronen-Emissions-Tomographie PS Parkinson Syndrom PINK1 PTEN-induced Kinase 1 q langer Arm eines Chromosoms RING1 RING-Finger-Domäne 1 RING2 RING-Finger-Domäne 2 RFLA Restriktionsfragmentlängenanalyse Roc Ras in complex proteins SN Substantia Nigra SNpc Substantia Nigra pars compacta SNPs Single Nucleotide Polymorphisms SSCP single-strand conformation polymorphism TM Transmembran Domäne UBL Ubiquitin-like Domäne Abkürzungsverzeichnis UPD Unique Parkin Domäne UPS Ubiquitin-Proteasom-System WD40 WD40 repeats z.B. zum Beispiel ZNS Zentrales Nervensystem Nukleobasen/Nukleotide A Adenin/Adenosin C Cytosin/Cytidin G Guanin/Guanidin T Thymin/Thymidin U Uracil/Uridin P Purin Y Pyrimidin N beliebige(s) Nukleobase/Nukleotid Aminosäuren A Ala Alanin M Met Methionin C Cys Cystein N Asn Asparagin D Asp Asparaginsäure P Pro Prolin E Glu Glutaminsäure Q Gln Glutamin F Phe Phenylalanin R Arg Arginin G Gly Glycin S Ser Serin H His Histidin T Thr Threonin I Ile Isoleucin V Val Valin K Lys Lysin W Trp Tryptophan L Leu Leucin Y Tyr Tyrosin Inhaltsverzeichnis 1 2 3 4 Einleitung 1 1.1 Klinisches Erscheinungsbild 2 1.2 Neuropathologie des MP 2 1.3 Pathogenese des MP 3 1.3.1 Das Ubiquitin-Proteasom-System 3 1.3.2 Mitochondriale Dysfunktion 3 Problemstellung 4 2.1 Genetische Faktoren 5 2.1.1 Familiäre Häufung 5 2.1.2 Zwillingsstudien 5 2.1.3 Genealogische Studien 6 2.2 Umweltfaktoren 6 2.3 Kandidatengene des MP 6 2.3.1 Parkin 8 2.3.2 PINK1 9 2.3.3 LRRK2 11 Ergebnisse 14 3.1 Analyse des Parkin Gens 14 3.2 Analyse des PINK1 Gens 16 3.3 Analyse des LRRK2 Gens 18 Diskussion 4.1 4.2 4.3 4.4 20 Parkin als Kandidatengen für die Late-Onset Form des MP 20 PINK1 als Kandidatengen für die Late-Onset Form des MP 23 Vergleich zwischen norwegischen und deutschen Patientenkohorten 24 Rolle des LRRK2 Gens bei deutschen MP Patienten 25 5 Zusammenfassung und Ausblick 30 6 Literaturverzeichnis 32 7 Danksagung 44 8 Lebenslauf 45 Einleitung 1 Einleitung Im Mittelpunkt dieser Promotionsarbeit steht der genetische Hintergrund von Morbus Parkinson (MP). Bei MP handelt es sich um eine sehr häufige chronisch progrediente, neurodegenerative Erkrankung des älteren Menschen, die in klassischer Weise mit der Symptomtrias Rigor, Tremor und Akinese einhergeht. Die Prävalenz steigt mit dem Alter: In der Gruppe der 65- bis 69-jährigen sind 0,6% betroffen, bei den 85- bis 89-jährigen schon 2,6% (De Rijk et al., 2000). Für eine seltene Unterform dieser Erkrankung, der mit sehr frühem Erkrankungsbeginn vor dem 45. Lebensjahr einhergehenden Early-Onset Form, konnten Mutationen in verschiedenen Genen als Ursache nachgewiesen werden. Die Rolle genetischer Faktoren bei der am häufigsten vorkommenden Late-Onset Form (Erkrankungsalter > 45 Jahre) wird kontrovers diskutiert. Obwohl bis zu 20% aller Parkinsonpatienten von ebenfalls erkrankten Verwandten berichten und nachgewiesenermaßen ein 3-4 fach erhöhtes Erkrankungsrisiko für Verwandte von Parkinsonpatienten besteht (Payami et al., 1994; Autere et al., 2000; Kurz et al., 2003), konnte man in Zwillingsstudien nur bei der Early-Onset Form Anhaltspunkte für eine mögliche Rolle genetischer Faktoren finden (Tanner et al., 1999). Gerade in der letzten Zeit wurde vermehrt auf eine Rolle von Mutationen im Parkin Gen bei der klassischen Late-Onset Form hingewiesen (Oliviera et al., 2003A; Faroud et al., 2003). Bei der Pathogenese des MP wird ein multifaktorielles Geschehen mit Umwelt- und genetischen Faktoren angenommen (Warner und Schapira, 2003). Daher beschäftigt sich die aktuelle Forschung u.a. mit der Suche nach Polymorphismen (SNPs, Single Nucleotide Polymorphisms) und Mutationen in den bekannten Kandidatengenen, um so mögliche, mit erhöhter Krankheitsanfälligkeit verbundene Suszeptibilitätsgene insbesondere auch für die Late-Onset Form zu definieren. Hierzu soll die vorliegende Promotionsarbeit bestehend aus drei aktuellen Publikationen (Schlitter et al., 2005; Schlitter et al., 2006A; Schlitter et al., 2006B) einen Beitrag leisten. 1 Einleitung 1.1 Klinisches Erscheinungsbild Das Parkinson Syndrom (PS) ist durch eine typische Symptomtrias bestehend aus Tremor, Rigor und Akinese gekennzeichnet. MP ist die häufigste Ursache eines PS und ist durch das Vorkommen von motorischen und nicht motorischen Symptomen charakterisiert. Zu den häufig bei MP beobachteten nicht motorischen Symptomen gehören Müdigkeit, Schlafstörungen, Obstipation sowie sensorische, gastrointestinale und sexuelle Störungen (Fahn, 2003). Ausserdem kommt es häufig zu psychiatrischen Komplikationen wie Depression und Angstzuständen sowie Demenzentwicklung (Weintraub, 2005). 1.2 Neuropathologie des MP MP ist neuropathologisch durch Verlust dopaminerger Neuronen und das Vorkommen von Lewy bodies (LBs) gekennzeichnet. Die neuronale Degeneration beschränkt sich nicht nur auf dopaminerge Zellen der Substantia Nigra pars compacta (SNpc), sondern betrifft auch die noradrenergen, serotonergen und cholinergen Systeme. Darüber hinaus sind auch der zerebrale Kortex, Bulbus olfactorii und das autonome Nervensystem betroffen (Braak et al., 2003). Durch den Verlust melaninhaltiger dopaminerger Neurone kommt es zur makroskopisch sichtbaren Depigmentierung der Substantia nigra (SN) (Marsden, 1983). An betroffenen Gehirnarealen können in den überlebenden Neuronen LBs nachgewiesen werden. Diese intraneuronalen Proteineinschlüsse befinden sich zytoplasmatisch, sind ubiquitinreich und bestehen aus αSynuclein sowie Amyloid ähnlichen Fibrillen (Fahn, 2003; Dauer und Przedborski, 2003). 2 Einleitung 1.3 Pathogenese des MP 1.3.1 Das Ubiquitin-Proteasom-System Erkenntnisse aus verschiedenen Forschungsrichtungen weisen auf eine Schlüsselfunktion des Ubiquitin-Proteasom-Systems (UPS) bei der Pathogenese des MP hin. Genprodukte zweier Gene der monogenen Formen des MP, Parkin und DJ-1, sind Bestandteile des UPS. Die Gabe von systemischen Inhibitoren des UPS führt im Tiermodell zu Entwicklung eines PS (McNaught et al., 2004). Mit Hilfe des UPS werden nicht korrekt gefaltete Proteine über mehrere Zwischenschritte mit Ubiquitin markiert und erhalten somit ein Signal zur Adenosin-5′-triphosphat (ATP)abhängigen Degradierung (McNaught et al., 2006). Neuste Erkenntnisse weisen zusätzlich darauf hin, dass dem UPS ausserdem eine zentrale Rolle bei der Regulation vieler zellulärer Prozesse wie z.B. Transkription und Signalverarbeitung zufällt (Marx, 2002). 1.3.2 Mitochondriale Dysfunktion Ein Zusammenhang zwischen selektivem Neuronenuntergang in der SNpc und mitochondrialer Dysfunktion wird schon seit längerer Zeit diskutiert (Schapira et al., 1998; Shen und Cookson, 2004; Muqit et al., 2006A). So zeigen post mortem-Untersuchungen an Gewebeproben des Zentralen Nervensystems (ZNS) von MP Patienten beschädigte Mitochondrien und oxydative Schädigung (Beal, 2003; Jenner, 2003). Des Weiteren führt die Einnahme von Inhibitoren des mitochondrialen Komplexes I wie 1-Methyl4-Phenyl-1,2,3,6-Tetrahydropyridin (MPTP), Rotenone und Paraquat binnen kürzester Zeit zum PS (Dauer und Przedborski, 2003). Durch die Identifizierung von Mutationen im PINK1 Gen bei MP Patienten konnte erstmals eine direkte molekulare Verbindung zwischen MP und mitochondrialer Dysfunktion gezeigt werden (Valente et al., 2004). 3 Problemstellung 2 Problemstellung Fast 200 Jahre nach der Erstbeschreibung des MP durch James Parkinson im Jahre 1817 ist die Ätiologie der Erkrankung noch weitgehend ungeklärt (Parkinson, 1817). Trotz intensiver Forschung wird über die Rolle genetischer Faktoren, insbesondere bei der klassischen Late-Onset Form kontrovers diskutiert. Erkenntnisse aus Familienstudien, Zwillingsforschung und genealogischen Studien sind dabei widersprüchlich. Die vorliegende Arbeit beschäftigt sich mit der Rolle verschiedener Gene bei MP und soll auch einen Beitrag zur aktuellen Diskussion leisten. Für die zwei wichtigsten autosomal-rezessiv vererbten Gene, Parkin und PINK1, wurde im Rahmen dieser Promotion eine Mutationsuntersuchung bei zwei europäischen MP Patientenkohorten durchgeführt. Die Analyse der beiden Gene PINK1 und Parkin erfolgte bei zwei verschiedenen Kohorten und wurde anschließend verglichen. Die Norwegische Kohorte stammt aus dem Umkreis von Stavanger im Westen von Norwegen, geht aus einer kleinen Gründerpopulation hervor und ist für ihre genetische Homogenität bekannt (Borg et al., 1999). Die deutsche Kohorte wurde im östlichen Ruhrgebiet zusammengestellt, repräsentiert eine typische urbane Population eines Ballungsgebietes und ist durch hohe genetische Heterogenität gekennzeichnet. Der Schwerpunkt der Analyse wurde auf die Bedeutung der beiden Gene bei der Late-Onset Form des MP gelegt. Desweiteren wurde für ausgewählte exonische SNPs in beiden Genen eine Assoziationstudie durchgeführt, um so mögliche Suszeptibilitätsfaktoren zu identifizieren. Die Familienanamnese sowie die Klinik der Mutationsträger wurden auf Besonderheiten hin untersucht. Für das LRRK2 Gen wurde eine Mutationsuntersuchung bei der deutschen Patientenkohorte mit dem Ziel durchgeführt, die Bedeutung von LRRK2 Mutationen bei deutschen MP Patienten näher zu bestimmen und die Untergruppen mit dem höhsten Risiko für Mutationen im LRRK2 Gen zu identifizieren. Bei zwei Mutationsträgern wurden im Rahmen einer multidisziplinären genetischen Beratung gemeinsam mit einem Facharzt für Neurologie der Familienstammbaum erhoben und die klinischen Daten vervollständigt. In 4 Problemstellung einem Fall wurden ausserdem weitere Familienmitglieder neurologisch und molekulargenetisch untersucht, um Informationen zu Penetranz und Pathogenität zu erlangen. 2.1 Genetische Faktoren 2.1.1 Familiäre Häufung Familiäre Häufung wird bei MP häufig beobachtet: 10-22% aller MP Patienten weisen eine positive Familienanamnese auf hinsichtlich ihrer Erkrankung (Lazzarini et al., 1994; Elbaz et al., 1999; Autere et al., 2000; Kurz et al., 2003), gesunde Kontrollpersonen hingegen nur in 3,5-3,8% (Elbaz et al., 1999; Autere et al., 2000). Die beobachtete familiäre Häufung resultiert dabei entweder aus gemeinsamen Umweltfaktoren, genetisch ähnlicher Ausstattung bzw. am wahrscheinlichsten aus einem Zusammenspiel mehrerer Faktoren aus beiden Kategorien. 2.1.2 Zwillingsstudien Zwillingsstudien ermöglichen eine weitere Differenzierung zwischen den oben genannten Faktoren (Bataille, 1999). Die meisten Zwillingsstudien sprechen gegen eine bedeutende Rolle erblicher Faktoren und unterstützen vielmehr die Theorie einer zentralen Rolle von Umweltfaktoren in der Pathogenese des MP. In einer der ersten Zwillingsstudien zum MP zeigte sich bei 12 eineiigen Zwillingspaaren keinerlei Konkordanz (Duvoisin et al., 1981). Auch zahlreiche weitere Zwillingsstudien gaben keine Hinweise für eine bedeutende erbliche Komponente (Ward et al., 1984; Marttila et al., 1988; Marsden, 1997; Vieregge et al., 1999; Wirdefeldt et al., 2004). Lediglich in einer sehr umfangreichen Studie wurden Hinweise für eine Rolle genetischer Faktoren für die Entwicklung von MP mit frühem Erkrankungsalter (<50 Jahre) gefunden (Tanner et al., 1999). Da MP jedoch eine lange Latenzperiode besitzt und präklinische Stadien der dopaminergen Dysfunktion durch klinische Untersuchungen unentdeckt bleiben, können 5 Problemstellung konventionelle Zwillingsstudien zu Verzerrungen führen. Diese Befürchtung wird durch drei Zwillingsstudien gestützt, bei denen die dopaminerge Dysfunktion mittels [18F]-Dopa und Positronen-EmissionsTomographie (PET) bestimmt wurde. Hierbei zeigten alle drei Studien höhere Konkordanzraten bei Zwillingen als herkömmliche Zwillingstudien (Burn et al., 1992; Piccini et al., 1999; Laihinen et al., 2000) sowie signifikant unterschiedliche Konkordanzraten von eineiigen und zweieiigen Zwillingen (Burn et al., 1992; Laihinen et al., 2000) und unterstützen so eindeutig die Rolle erblicher Faktoren. 2.1.3 Genealogische Studien Eine genealogische Studie mit Daten der isländischen Bevölkerung spricht für eine Rolle genetischer Faktoren bei der Early-Onset ebenso wie bei der Late-Onset Form des MP. In dieser bisher einzigartigen Studie wurde gezeigt, dass MP Patienten signifikant näher verwandt sind als gesunde Kontrollpersonen (Sveinbjornsdottir et al., 2000). 2.2 Umweltfaktoren Schon lange wird vermutet, dass auch Umweltfaktoren, besonders nach einer langen Latenzzeit, als Krankheitsauslöser fungieren könnten. Eine besondere Schlüsselrolle wird dabei den Pestiziden und Insektiziden wie z.B. den mitochondrialen Komplex I Inhibitoren Paraquat und Rotenone zugeschrieben (Priyadarshi et al., 2000; Warner und Schapira, 2003; Brown et al., 2006). 2.3 Kandidatengene des MP Durch Kopplungsanalysen in Familien mit erblichen Formen des MP konnten in den letzten Jahren verschiedene loci und Gene identifiziert werden, bei denen bestimmten Sequenzvariationen als Krankheitsursache angesehen werden. Patienten der betroffenen Familien leiden zum größten Teil an der seltenen Early-Onset Form des MP. Auch wenn es sich bei den monogenen Formen des MP bisher um seltene Befunde 6 Problemstellung handelt, ermöglichen sie doch Einblicke in die zur Neurodegeneration führenden molekularen Mechanismen und versprechen neue Erkenntnisse zur Entwicklung zusätzlicher Therapiestrategien. In Tabelle 2.1 sind monogene Formen des MP aufgelistet. Im Rahmen der vorliegenden Promotionsarbeit wurde der Schwerpunkt auf die drei Gene mit den höchsten Mutationsraten gelegt: Parkin, Pink1 und LRRK2 (Schlitter et al., 2005; Schlitter et al., 2006A; Schlitter et al., 2006B). Tabelle 2.1: Übersicht über monogene Formen des MP Gene locus Ursächliches Gen Funktion Vererbung s-modus Referenz PARK1 Chromosomale Region 4q21.3 α-Synuclein ? Polymeropoulos et al., 1997 PARK2 6q25.2-q27 Parkin PARK3 2p13 ? E3 ProteinUbiquitin Ligase ? Autosomaldominant (AD) Autosomalrezessiv (AR) AD PARK4 4p15 α-Synuclein Multiplikation ? AD PARK5 4p14 UCHL1 AD PARK6 1p35-p36 PINK1 UbiquitinHydrolase/Ligase Proteinkinase AR PARK7 1p36 DJ1 ? AR PARK8 12p11.2q13.1 LRRK2 Proteinkinase AD ? ? AR PARK9 PARK10 1p32 ? ? AD PARK11 2q36-q37 ? ? AD PARK12 Xq21-q25. ? ? Xchromosomall 7 Kitada et al., 1998 Gasser et al., 1998 Singleton et al., 2003; Chartier-Harlin et al., 2004 Leroy et al., 1998 Valente et al., 2004 Van Duijn et al., 2001; Bonifati et al., 2003 Paisan-Ruiz et al., 2004; Zimprich et al., 2004 Hampshire et al. 2001 Hicks et al., 2002 Pankratz et al., 2003B Pankratz et al., 2003A Problemstellung 2.3.1 Parkin Gen Seit der Identifizierung des Parkin Gens (Kitada et al., 1998) wurde eine Vielzahl putativ krankheitsverursachender Mutationen und Deletionen beschrieben (Hedrich et al., 2004). Mittlerweile steht fest, dass bis zu 50% aller autosomal-rezessiv vererbten und etwa 15% aller sporadischen Early-Onset Formen des MP auf Veränderungen im Parkin Gen zurückgeführt werden können (Lucking et al., 2000; Periquet et al., 2003). Das Parkin Gen befindet sich auf Chromosom 6 in der Region 6q25.2-27 und umfasst 12 Exons. Es kodiert für eine 465 Aminosäuren (AS) umfassende E3-Ubiquitin-Ligase mit einem Molekulargewicht von 52 kDa. Diese Ligase gehört zu den Schlüsselenzymen des UPS und interagiert mit weiteren Enzymen (z.B. E2-Ubiquitin-Ligasen) und Substraten. Die Domänenstruktur des Parkin Proteins zeigt hohe Analogie zu anderen E3Ligasen: am N-terminalen Ende befindet sich eine Ubiquitin-like Domäne (UBL), es folgt die UPD Domäne (Unique Parkin Domäne) sowie Cterminal zwei RING-Finger-Domänen (RING1 und RING2), die durch eine In-Between-RING-Finger Domäne (IBR) getrennt sind (siehe Abbildung 1.1). Exon 7 und 11 des Parkin Gens kodieren für die funktionell wichtige RING-Finger-Domänen (RING1 und RING2). Mit aktiviertem Ubiquitin beladene E2-Ligasen wie UbCH7 und UbCH8 binden an diese RINGFinger-Domänen, insbesondere an RING1 (Shimura et al., 2000; Tanaka et al., 2001). Die meisten bisher identifizierten Punktmutationen betreffen die zwei RING-Finger-Domänen und unterstreichen so die Wichtigkeit dieser Domänen (Von Coelln et al., 2005). Patienten mit krankheitsverursachenden Veränderungen des Parkin Gens in homozygotem bzw. compound heterozygotem Zustand erkranken an der Early-Onset Form des MP. Das Manifestationsalter unterscheidet sich stark zwischen den unterschiedlichen Mutationen. Es variiert aber auch innerhalb von Familien mit identischen Mutationen um bis zu 20 Jahre (Von Coelln et al., 2005) und lässt auf Modulationsfaktoren in Form von genetischen und/oder Umwelteinflüssen schließen. Gerade in der letzten Zeit wurde vermehrt auf eine mögliche Rolle von Mutationen des Parkin Gens bei der klassischen Late-Onset Form hingewiesen (Foroud et al., 2003). Mutationen im heterozygoten Zustand, insbesondere Mutationen im 8 Problemstellung Exon 7, scheinen als Suszeptibilitätsgene für die Late-Onset Form des MP zu wirken (Oliveira et al., 2003A). Lucking et al. konnte eine signifikante Assoziation des V380 Allel mit sporadischem MP zeigen (Lucking et al., 2003). Funktionelle Untersuchungen mittels PET weisen ebenfalls auf eine Rolle von Mutationen im heterozygoten Zustand des Parkin Gens hin: Asymptomatische Träger einer Mutation im Parkin Gen im heterozygoten Zustand zeigen in funktionellen Untersuchungen im Vergleich zu gesunden Kontrollen eine signifikant reduzierte 18F-Dopa Aufnahme (Khan et al., 2005), die auf subklinisch dopaminerge Dysfunktion schließen lässt. 1 465 AS UBL RING1 UPD IBR RING2 Abbildung 2.1: Schema der durch Parkin kodierten E3-Ubiquitin-Ligase. Eine Ubiquitin-like Domäne (UBL) liegt N-terminal, es folgt die UPD Domäne (Unique Parkin Domäne). C-Terminal befinden sich zwei RING-Finger-Domänen (RING1 und RING2), die durch eine In-Between-RING-Finger Domäne (IBR) getrennt werden (Tanaka et al., 2001). 2.3.2 PINK1 Gen Mutationen im PINK1 (PTEN-induced kinase 1) Gen gelten nach Mutationen im Parkin Gen als zweithäufigste Ursache der seltenen, autosomal-rezessiv vererbten Early-Onset Form des MP (Valente et al., 2004; Hatano et al., 2004). Das PINK1 Gen liegt in der Chromosomenregion 1q35-p36 und umfasst 8 Exons. Es kodiert für eine 581 AS große Proteinkinase, welche ubiqitär transkribiert und anschließend mitochondrial eingeschleust wird (siehe Abbildung 1.2) (Silvestri et al., 2005; Gandhi et al., 2006). PINK1 wurde erstmals im Zusammenhang mit dem PTEN Signalweg beschrieben, welcher eine Rolle bei Tumorentstehung, neuronaler Differenzierung, embryonaler Entwicklung und neuronaler Apoptose spielt (Unoki und Nakamura, 2001; Gary und Mattson, 2002). Die genaue Funktion des PINK1 Proteins ist 9 Problemstellung noch unklar; es wird jedoch eine protektive Eigenschaft gegenüber zellulärem Stress vermutet. Dies könnte etwa durch Phosphorylierung mitochondrialer Proteine als Antwort auf oxidativen Stress geschehen (Valente et al., 2004). Desweiteren konnte eine protektive Funktion des PINK1 Proteins gegenüber neuronaler Apoptose bewiesen werden (Petit et al., 2005). Durch die Identifizierung krankheitsverursachender Mutationen im PINK1 Gen wurde erstmals eine direkte molekulare Verbindung zwischen MP und mitochondrialer Dysfunktion gezeigt. Bei den bisher identifizierten Mutationen handelt es sich fast ausschließlich um Fehlsinnmutation im Bereich der Kinase Domäne. Im Gegensatz zu Beobachtungen im Parkin und DJ-1 (PARK7) Gen scheinen Deletionen und erhöhte Kopienanzahl keine große Rolle zu spielen (Valente et al., 2004). Das klinische Bild von Patienten mit homozygot vorhandenen Mutationen im PINK1 Gen unterscheidet sich nur durch das frühe Manifestationsalter der klassischen Late-Onset Form des MP (Bentivoglio et al., 2001). Für Mutationen des PINK1 Gens im heterozygoten Zustand wird analog zum Parkin Gen eine mögliche Rolle als Risikofaktor des MP diskutiert (Healy et al., 2004, Djarmati et al., 2006; Hedrich et al., 2006). So zeigen gesunde, heterozygote Träger einer Mutation in PET Untersuchungen im Vergleich zu gesunden Kontrollen signifikant reduzierte 18F-Dopa Aufnahme (Khan et al., 2002). Diese subklinisch dopaminerge Dysfunktion könnte durch Triggerfaktoren etwa in Form von Umwelt- oder zusätzlichen genetischen Faktoren zur Manifestation des MP führen. 10 Problemstellung 1 581 AS Mitrochondrial targeting motif TM Ser/Thr Protein Kinase Domäne Abbildung 2.2: Schema des PINK1 Genprodukts. Die Kinasedomäne ist streng konserviert und weist hohe Homologie zu den Serin/Threonin Kinasen der Ca2+/Calmodulin Familie auf. Am N-terminalen Ende befindet sich eine mitochondrial targeting peptide Sequenz, die der posttranslationalen Einschleusung in die Mitochondrien dient. Zwischen diesen beiden Dömanen befindet sich zusätzlich eine Transmembran Domäne (TM) (Valente et al., 2004, Silvestri et al., 2005). 2.3.3 LRRK2 Gen Seit der Identifizierung von Mutationen im LRRK2 Gen (Leucine-rich repeat Kinase 2) bei MP Patienten (Paisan-Ruiz et al., 2004; Zimprich et al., 2004) steht dieses Gen und besonders die häufige Mutation G2019S im Fokus der Parkinsonforschung. Während bisher, abgesehen vom Parkin Gen, krankheitsverursachende Mutationen nur in einigen wenigen Familien gefunden wurden, erscheinen zunehmend Positivbefunde für das LRRK2 Gen. Der PARK8 Locus wurde bereits zwei Jahre vorher durch eine genomweite Kopplungsanalyse in einer japanischen Familie mit AD vererbtem MP identifiziert und später als LRRK2 verursachter MP bestätigt (Funayama et al., 2002; Funayama et al., 2005). Das LRRK2 Gen liegt im Locus PARK8 in der Chromosomenregion 12p11.2-q13.1. Es umfasst 51 Exons und codiert für das 2527 AS große Protein LRRK2/Dardarin. Das Protein gehört zu der erst kürzlich beschriebenen Familie der ROCO Proteine (Bosgraaf und van Haastert, 2003). LRRK2 besitzt 5 hochkonservierte Domänen (siehe Abbildung 1.3), unter anderem die funktionell sehr wichtige Kinasedomäne (Zimprich et al., 2004). Die Leucine-rich repeat (LRR) und WD40 repeats (WD40) Domänen scheinen eine Rolle bei der Protein/Protein Interaktion zu spielen (zitiert bei Li und Beal, 2005). Dardarin wird in zahlreichen Geweben einschließlich des 11 Problemstellung Gehirns exprimiert, so unter anderem auch in der SN (Paisan-Ruiz et al., 2004; West et al., 2005). In der Zelle befindet sich Dardarin hauptsächlich im Zytoplasma. Daneben kommt es jedoch auch in der äußeren Mitochondrienmembran vor. Interessanterweise scheint Dardarin zusätzlich auch ein Substrat des UPS zu sein (West et al., 2005). Das klinische Bild und die Neuropathologie der LRRK2 Mutationsträger unterscheidet sich kaum vom klassischen MP (Adams et al., 2005; Hernandez et al., 2005). Auch neuropsychiatrische Symptome wie Depression, Reizbarkeit und Halluzinationen sind häufig (Goldwurm et al., 2006). Neuropathologisch zeigt sich die typische Neurodegeneration der SN. Zusätzlich findet sich ein breites Spektrum von den klassischen αSynuclein haltigen LBs, Tau Pathologie wie bei der progressiven supranuklearen Lähmung bis zu ß-Amyloid Plaques (Zimprich et al., 2004; Brice, 2005; Giasson et al., 2006). Trotz Überlappungen in der Neuropathologie und Ergebnissen einer Kopplungsanalyse bei Morbus Alzheimer (MA) (Scott et al., 2000; Zimprich et al., 2004), scheint keine der häufigen Mutationen mit MA assoziiert zu sein (Toft et al., 2005; Zabetian et al., 2006). Besonderes Interesse erregt derzeit die Mutation G2019S (Di Fonzo et al., 2005; Gilks et al., 2005; Nichols et al., 2005), die in bisher > 50 betroffenen Familien und nur in einer von > 3000 gesunden Kontrollen gefunden wurde (Kay et al., 2005; Singleton et al., 2005). Es wird vermutet, dass bis zu 1-2% der sporadischen und 5-6% aller familiären MP Fälle auf diese Mutation zurückzuführen sind (Di Fonzo et al., 2005; Gilks et al., 2005; Nichols et al., 2005). Befunde in verschiedenen Populationen aus Europa und Nordamerika sowie Haplotyp-Analysen weisen darauf hin, dass sich die Mutation auf einen gemeinsamen Vorfahren (common founder) zurückführen lässt (Lesage et al., 2005; Kachergus et al., 2005). Das Manifestationsalter von Mutationsträgern variiert stark (35-78 Jahre), auch innerhalb von einzelnen Familien, und umfasst sowohl Early-Onset als auch Late-Onset Formen mit typischen Symptomen des klassischen MP (Singleton et al., 2005). Es wird von einer altersabhängigen Penetranz ausgegangen (Kachergus et al., 2005), die durch Umwelt- und/oder genetische Faktoren getriggert werden könnte. Die Hypothese modifizierender Umweltfaktoren 12 Problemstellung wird durch die Identifizierung eines monozygoten Zwillingspaars mit der G2019S Mutation unterstützt. Ein Zwilling war im Alter von 38 Jahren erkrankt, der andere Zwilling mit 62 Jahren neurologisch (noch) unauffällig (Singleton et al., 2005). Neben der Mutation G2019S wurden > 20 weitere Mutationen in verschiedenen Domänen des Gens gefunden (Mata et al., 2006). Für einige pathogene Mutationen konnte in Zellversuchen gezeigt werden, dass sie zu Zelltod und Bildung von Einschlusskörperchen führen (Greggio et al., 2006). Bei den beobachteten Zelleffekten scheint die Kinaseaktivität eine Schlüsselrolle zu spielen (Greggio et al., 2006): Die beiden häufigen Mutationen G2019S und R1441C führen zur erhöhten Kinaseaktivität (West et al., 2005). Versuche mit Inhibitoren der Kinaseaktivität verzögern den Zelltod und verhindern die Bildung von Einschlusskörperchen. Diese Beobachtungen legen eine therapeutische Nutzung von Inhibitoren der Kinaseaktivität bei Patienten mit LRRK2 Mutationen und vielleicht sogar bei Patienten mit sporadischem MP nahe (Greggio et al., 2006). 1 2527 AS LRR ROC COR MAPKKK WD40 Abbildung 2.3: Schematische Darstellung der Struktur des LRRK2 Gens. Das LRRK2 Protein weisst fünf hochkonservierte Domänen auf: eine LRR Domäne (leucine rich repeat), Roc (Ras in complex proteins) und COR Domänen (C-terminal domain of Roc), eine MAPKKK Domäne (mitogen activated Protein Kinase Kinase Kinase) sowie eine WD40 Domäne (WD40 repeats) (Zimprich et al., 2004; Kachergus et al., 2005). 13 Ergebnisse 3 Ergebnisse 3.1 Analyse des Parkin Gens Zusammenfassung der Publikation „Parkin gene varations in lateonset Parkinson´s disease: comparison between Norwegian and German cohorts“ (Schlitter et al., 2005). Einleitung. Mutationen im Parkin Gen führen zur autosomal-rezessiv vererbten Early-Onset Form des MP (Kitada et al., 1998). In der letzten Zeit häufen sich die Hinweise, dass Mutationen und bestimmte SNPs im Parkin Gen auch bei der klassischen Late-Onset Form eine Rolle spielen könnten (Foroud et al., 2003; Oliveira et al., 2003A; Lucking et al., 2003). Zielsetzung. Ziel der Arbeit „Parkin gene varations in late-onset Parkinson´s disease: comparison between Norwegian and German cohorts“ ist eine Analyse des Parkin Gens auf Mutationen und SNPs bei MP Patienten, die vornehmlich an der Late-Onset Form erkrankt sind. Material und Methoden. Das komplette Parkin Gen wurde bei einer deutschen (95 Patienten) und einer norwegischen Patientenkohorte (96 Patienten) auf Mutationen und SNPs untersucht. Die molekulargenetischen Untersuchungen wurden mittels polymerase chain reaction (PCR), single-strand conformation polymorphism (SSCP) Analyse und DNA-Sequenzieren durchgeführt. Gesunde Kontrollpersonen wurden mit Hilfe von Restriktionsfragmentlängenanalyse (RFLA) auf spezielle Mutationen und SNPs untersucht. Ein Allelfrequenzvergleich erfolgte mittels χ2-Test. Ergebnisse. Bei der Mutationsanalyse in zwei europäischen Patientenkohorten wurden drei bereits beschriebene Mutationen bei vier verschiedenen Patienten gefunden (T240M, R402C und R256C). Alle Mutationsträger sind an der Late-Onset Form des MP erkrankt (Erkrankungsbeginn 52-65 Jahre). Im deutschen Patientenkollektiv wurden insgesamt drei Mutationen im heterozygoten Zustand identifiziert (T240M, R402C und R256C; 1,6%). Dies entspricht einer Mutationsträgerrate von 3,2%. Die Mutation T240M wurde ebenfalls in 14 Ergebnisse heterozygotem Zustand bei einer von 147 gesunden Kontrollpersonen aus Deutschland gefunden (Alter bei Blutentnahme 44 Jahre), die beiden anderen Mutationen wurden nicht bei Kontrollenpersonen gefunden. In der norwegischen Patientenkohorte wurde nur bei einem Patienten eine Mutation im heterozygoten Zustand gefunden (R256C; 0,5%). Bei 100 untersuchten gesunden Kontrollpersonen aus Norwegen wurde kein Mutationsträger mit dieser Mutation identifiziert. Zusätzlich wurden mehrere intronische und exonische SNPs identifiziert (siehe Tabelle 1.2). Die intronischen SNPs Ivs2+25T>C (p=0,015), Ivs7-35G>A (p=0,013) und Ivs8+48C>T (p=0,029) wurden signifikant häufiger in der deutschen Patientenkohorte identifiziert. Drei bereits als exonische SNPs beschriebene Sequenzvariationen (V380L, S167N und D394N) waren ebenfalls häufiger in der deutschen Patientenkohorte vorhanden, lediglich der Austausch A82E wurde nur in der norwegischen Patientenkohorte identifiziert. Das V380 Allel war signifikant häufiger in der norwegischen Kohorte (p=0,0081). Ein Vergleich der V380L Frequenz zwischen Patienten (sporadische und familiäre MP Patienten) und gesunden Kontrollen zeigte keine signifikanten Frequenzunterschiede, weder für die deutsche (p=0,43; 147 gesunde deutsche Kontrollen), noch für die norwegische Kohorte (p=0,74; 112 gesunde norwegische Kontrollen). In Anlehnung an das Studiendesign von Lucking et al. (Lucking et al., 2003) wurde zusätzlich die V380L Frequenz zwischen sporadischen MP Patienten und gesunden Kontrollen verglichen. Auch hier zeigten sich keine signifikanten Unterschiede, weder für die norwegische (p=0,96), noch für die deutsche Patientenkohorte (p=0,7). Diskussion. Zwei europäische Patientenkohorten wurden auf Sequenzvariationen im Parkin Gen untersucht. Dabei wurden insgesamt vier Mutationen in heterozygotem Zustand bei Patienten mit der LateOnset Form des MP identifiziert, eine Mutation in der norwegischen Kohorte (R256C; 0,5%), drei in der deutschen Kohorte (R256C; R402C, T240M; 1,6%). Diese Ergebnisse unterstützten die Hypothese, dass Parkin Mutationen im heterozygoten Zustand als Suszeptibilitätsallele zu wirken scheinen (Faroud et al., 2003; Oliveira et al., 2003A). Ein möglicher Wirkmechanismus der Mutationen im heterozygoten Zustand könnte z.B. 15 Ergebnisse Haploinsuffizienz sein (Oliveira et al., 2003A; Von Coelln et al., 2004). Die beschriebene Hypothese einer Assoziation des V380 Allels mit sporadischem MP (Lucking et al., 2003) konnte nicht bestätigt werden. Tabelle 3.1: SNPs im Parkin Gen, die nach Mutationsanalyse bei norwegischen und deutschen MP Patienten identifiziert wurden. Exon Sequenzvariation ProteinA ( = Vorkommen im austausch heterozygoten Zustand, B = Vorkommen im homozygoten Zustand) Norwegische Patientenkohorte (%) Deutsche Patientenkohorte (%) 2 Ivs2+25T>CA 23.9 37.6 2 Ivs2+25T>CB 4.2 7.5 2 1 1 3 4 4 4 8 8 8 8 10 10 10 Ivs2+35G>AA Ivs2+25T>CA 346C>AA Ivs3-20T>CA Ivs3-20T>CB 601G>AA Ivs7-35G>AA Ivs7-35G>AB Ivs8+48C>TA Ivs8+48C>TB 1237G>AA 1237G>AB 1113G>AA 1 0 9.4 0 3.1 12.5 6.25 9.4 10.8 0 1 1 18.9 4.2 3.2 0 24.1 0 20.9 36.8 1 0 11 1281G>AA 0 1 A82E S167N V380L L380 Kein AS Austausch D394N 3.2 Analyse des PINK1 Gens Zusammenfassung der Publikation „Exclusion of PINK1 as candidate gene for the late-onset form of Parkinson´s disease in two European populations“ (Schlitter et al., 2005). Einleitung. Mutationen im kürzlich entdeckten PINK1 Gen gelten nach Mutationen im Parkin Gen als zweithäufigste Ursache der seltenen, autosomal-rezessiv vererbten Early-Onset Form des MP (Valente et al., 16 Ergebnisse 2004; Hatano et al., 2004). Dem PINK1 Protein wird eine protektive Funktion gegenüber zellulärem Stress in Mitochondrien zugeschrieben (Valente et al., 2004). Da auch bei der klassischen Form des MP eine mitochondriale Beteiligung vermutet wird, stellt sich die Frage, ob das PINK1 Gen nicht auch eine Rolle bei der häufigen Late-Onset Form des MP spielen könnte. Zielsetzung. Ziel der Arbeit „Exclusion of PINK1 as candidate gene for the late-onset form of Parkinson´s disease in two European populations“ ist eine Mutationsanalyse des PINK1 Gens bei Patienten mit der Late-Onset Form des MP aus zwei unterschiedlichen Populationen. Material und Methoden. Das komplette PINK1 Gen wurde bei einer deutschen (85 Patienten) und einer norwegischen Patientenkohorte (90 Patienten) auf Mutationen und SNPs untersucht. Die molekulargenetischen Untersuchungen wurden mittels PCR, SSCP, denaturating high performance liquid chromatography (DHPLC) und DNASequenzieren durchgeführt. Allelfrequenzen wurden mit Hilfe des χ2-Test verglichen. Ergebnisse. Mehrere intronische (Ivs4-5A>G het, Ivs6+43C>T het, c.1783A>T) und exonische SNPs (L63L, Q115L, N521T) wurden identifiziert. Die Allelfrequenzen von drei untersuchten SNPs (L63L, Ivs45A>G, Ivs6+43C>T) zeigten signifikante Unterschiede zwischen den beiden untersuchten Kohorten. Für die erst kürzlich beschriebene Sequenzvariation Q115L (Klein et al., 2005) erfolgte eine Genotypisierung via DHPLC für Patienten und gesunde norwegische bzw. deutsche Kontrollpersonen. Die beobachteten Frequenzen zeigten keine signifikanten Frequenzunterschiede zwischen Patienten und gesunden Kontrollen, weder für die deutsche (p=0,27) noch für die norwegische Kohorte (p=0,8). Insgesamt wurden weder in der deutschen noch in der norwegischen Kohorte pathogene Mutationen gefunden. Diskussion. In der vorliegenden Studie wurde die Relevanz des PINK1 Gens für die Late-Onset Form des MP untersucht. Für Patientenkohorten aus zwei unterschiedlichen Populationen konnte die Relevanz von Sequenzvariationen im PINK1 Gen weitgehend ausgeschlossen werden. Die erst kürzlich beschriebene Sequenzvariation Q115L zeigte bei beiden 17 Ergebnisse Patientenkohorten keine Assoziation mit MP. Auch pathogene Mutationen im PINK1 Gen scheinen bei den hier untersuchten Late-Onset Patientenkohorten, wenn überhaupt, nur eine marginale Rolle zu spielen. Um die fehlende Relevanz des PINK1 Gens bei Late-Onset Patienten endgültig darzulegen, sollten zukünftige Untersuchungen auch Veränderungen im Promotor sowie in enhancer/silencer Regionen ausschließen. 3.3 Analyse des LRRK2 Gens Zusammenfassung der Publikation „The LRRK2 gene in Parkinson´s disease: mutation screening in patients from Germany“ (Schlitter et al., 2006B). Einleitung. Das LRRK2 Gen ist das zuletzt beschriebene Kandidatengen des MP (Paisan-Ruiz et al., 2004; Zimprich et al., 2004). Durch die große Anzahl bisher identifizierter Mutationsträger und der daraus resultierenden Relevanz des Gens wird eine steigende Nachfrage nach DNA Diagnostik und genetischer Beratung erwartet. Daher ist es wichtig, Patientensubpopulationen mit der höchsten Mutationswahrscheinlichkeit zu identifizieren sowie Penetranz und Frequenz einzelner Mutationen näher zu ermitteln. Zielsetzung. Ziel der Arbeit „The LRRK2 gene in Parkinson´s disease: mutation screening in patients from Germany“ ist eine Mutationsanalyse des LRRK2 Gens in einer deutschen MP Kohorte. Material und Methoden. Neun Exons des LRRK2 Gens, in denen bereits Mutationen gefunden wurden (Exons 19, 24, 25, 29, 31, 34, 35, 38 und 41), wurden mittels PCR, DHPLC und Sequenzierung analysiert. Dabei wurden 120 Patienten aus Deutschland (92% Late-Onset und 8% EarlyOnset Patienten; positive Familienanamnese in 25,8%) untersucht. Ergebnisse. Bei der Untersuchung wurden häufige exonische (G1624G, K1637K, S1647T) und intronische (Ivs33-31T>C, Ivs34+32A>G, Ivs3451A>T, Ivs35+23T>A, Ivs38+35G>A) SNPs gefunden. Mutationen im heterozygoten Zustand wurden bei drei Patienten identifiziert: insgesamt 18 Ergebnisse zwei Patienten tragen die häufige Mutation G2019S (Erkrankungsalter der Mutationsträger: 30 und 44 Jahre), ein dritter Patient ist Mutationsträger der bisher unbeschriebenen Mutation A1151T (Erkrankungsalter 55 Jahre). Bei 168 gesunden Kontrollen wurde weder die Mutationen A1151T, noch die häufige Mutation G2019S beobachtet. Diskussion. In der Mutationsanalyse des LRRK2 Gens bei deutschen MP Patienten wurden insgesamt drei Patienten (2,5%) mit putativ pathogenen Mutationen identifiziert (G2019S, A1151T). Da mit 9 von 51 Exons des Gens nur ein kleiner Teil untersucht wurde, ist die tatsächliche Mutationsfrequenz in der Patientenkohorte wahrscheinlich noch höher. Zwei an der Early-Onset Form erkrankte Patienten sind Träger der weltweit am häufigsten beschriebenen Mutation G2019S. Bei einer weiteren, im Alter von 55 Jahren erkrankten Late-Onset Patientin wurde die neue Mutation A1151T identifiziert. Das größte Risiko für eine LRRK2 Mutation zeigten in unserer Studie Patienten, die an der Early-Onset Form des MP leiden: zwei von insgesamt zehn Patienten sind Träger einer LRRK2 Mutation, unter den Late-Onset Patienten hingegen nur 1 von 110. Um diese beobachtete Tendenz zu bestätigen, sind allerdings Untersuchungen in noch größeren Kohorten notwendig. 19 Diskussion 4 Diskussion Die dargestellten Untersuchungen bzgl. der Gene Parkin, PINK1 und LRRK2 in MP Patienten und Kontrollen haben Ergebnisse erbracht, die nun im Einzelnen diskutiert werden. Dabei geht die Diskussion zum Teil über den Stand in den betreffenden Veröffentlichungen hinaus, da einige interessante Ergebnisse erst kürzlich publiziert wurden und zum jeweiligen Zeitpunkt der Veröffentlichungen noch nicht bekannt waren. 4.1 Parkin als Kandidatengen für die Late-Onset Form des MP Parkin Mutationen im heterozygoten Zustand bei Late-Onset Patienten. Zwei europäische Patientenkohorten wurden auf Sequenzvariationen im Parkin Gen untersucht. Dabei wurden insgesamt vier Mutationssträger unter den MP Patienten identifiziert, einer in der norwegischen Kohorte (R256C; 0,5%), drei in der deutschen Kohorte (R256C; R402C, T240M; 1,6%). Alle Mutationen wurden in heterozygotem Zustand bei Patienten mit der Late-Onset Form des MP gefunden. Diese Ergebnisse unterstützten die Hypothese, dass Parkin Mutationen im heterozygoten Zustand als Suszeptibilitätsallele zu wirken scheinen (Faroud et al., 2003; Oliveira et al., 2003A). Da der Anteil an Mutationsträgern mit 1% bzw. 3,2% jedoch gering ist, können Parkin Mutationen im heterozygoten Zustand als Hauptursache der Krankheitsentstehung der Late-Onset Formen des MP ausgeschlossen werden. Auf den ersten Blick lässt sich das ausschliessliche Vorkommen von Mutationen im heterozygoten Zustand bei MP Patienten nur schwer mit einer autosomal-rezessiv vererbten Erkrankung vereinbaren. Die Wahrscheinlichkeit, potentielle Mutationen zu übersehen, wurde durch optimierte Standardprotokolle bei der SSCP Analyse minimiert (Jaeckel et al., 1998). Das Phänomen von Parkin Mutationen im heterozygoten Zustand bei MP Patienten wurde allerdings auch schon von anderen Gruppen berichtet und scheint daher kein Zufallsbefund zu sein (West et 20 Diskussion al., 2002; Faroud et al., 2003; Oliveira et al., 2003A). Von mehreren Autoren wurde Haploinsuffizienz als Wirkmechansimus der Mutationen im heterozygoten Zustand vorgeschlagen (Oliveira et al., 2003A; Von Coelln et al., 2004). Oxidativer Stress könnte dabei zu einer Manifestation der Haploinsuffizienz führen (Von Coelln et al., 2004). Das vorgeschlagene Modell harmoniert mit der Hypothese, dass Genetik und Umweltfaktoren synergistisch an der Entstehung des MP beteiligt sind (Warner und Schapira, 2003). Untersuchungen mittels PET unterstützen ebenfalls die Hypothese, dass Parkin Mutationen auch im heterozygoten Zustand pathogene Wirkung haben: Asymptomatische Träger einer Mutation im Parkin Gen im heterozygoten Zustand zeigen in funktionellen Untersuchungen im Vergleich zu gesunden Kontrollen signifikant reduzierte 18F-Dopa Aufnahme (Khan et al., 2005). Diese subklinische dopaminerge Dysfunktion erhöht das Risiko massiv, zu einem späteren Zeitpunkt an MP zu erkranken. Während zum Zeitpunkt unserer Veröffentlichung die Rolle von Mutationen im heterozygoten Zustand als Risikofaktor für die Entstehung des MP kontrovers dikutiert wurde, etabliert sich die Hypothese inzwischen immer mehr und ist mittlerweile Gegenstand erweiterter klinischer Untersuchungen (Hedrich et al., 2006; Sun et al., 2006; Beffert and Rosenberg, 2006). Bei einer Untersuchung des gesamten Parkin Gens bei 105 gesunden Kontrollpersonen konnten keine Mutationen, weder im heterozygoten noch im homozygoten Zustand, identifiziert werden (Sun et al., 2006). Diese Untersuchung unterstützt die Hypothese, dass bereits im heterozygoten Zustand vorliegende Mutationen pathogen sind und deshalb gehäuft bei MP Patienten und nicht bei gesunden Kontrollpersonen gefunden werden. Desweiteren scheint die Anzahl der betroffenene Allele des Parkin Gens Einfluss auf das Erkrankungsalter zu haben: Patienten mit einem mutierten Allel erkranken etwa 12 Jahre früher als Patienten ohne Mutation und circa 13 Jahre später als Träger einer Mutation im homozygoten Zustand (Sun et al., 2006). Dies erklärt die Beobachtung, dass besonders Late-Onset Patienten Mutationen heterozygot aufweisen und homozygot vorhandene Mutationen hauptsächlich bei Early-Onset Patienten zu finden sind. 21 Diskussion Mutation R402C. Die bereits im Zusammenhang mit der Early-Onset Form beschriebene Fehlsinnmutation R402C (Bertoli-Avella et al., 2005) wurde auch bei einer von 149 gesunden Kontrollperson (0,3%) in heterozygotem Zustand gefunden. Obwohl die Kontrollperson zum Zeitpunkt der Blutabnahme im Alter von 44 Jahren gesund war, ist eine spätere Manifestierung der Erkrankung (geschätzte Prävalenz ~0,02%) nicht auszuschließen. Mutation R256C. Die Fehlsinnmutation R256C wurde in beiden Patientenkohorten gefunden. Sie befindet sich im Exon 7 und betrifft die erste RING-Finger Domäne des Parkin Proteins. Diese Domäne interagiert mit E2 Ubiquitin-Konjugations-Enzymen wie der UbcH7 im UPS (Shimura et al., 2000). Die Fehlsinnmutation R256C führt zu Einschlüssen im Zytoplasma und im Zellkern und könnte so zur Pathogenese beitragen (Cookson et al., 2003). Das Vorkommen dieser Mutation in beiden Patientenkohorten sowie der oben beschriebene Pathomechanismus unterstützen die Hypothese, dass besonders Mutationen im Exon 7 eine Rolle als Suszeptibilitätsallele bei der Late-Onset Form spielen (Oliveira et al., 2003A). Mutationen und ‚kleinere’ Deletionen wurden bisher über das komplette Parkin Gene verteilt gefunden. Dennoch stellt Exon 7 neben Exon 2 eine hot spot Region des Parkin Gens dar (Hedrich et al., 2004), die auch in unserer Untersuchung bestätigt werden konnte. Polymorphismus V380L. Unsere Daten widersprechen in zweifacher Weise der Hypothese einer beschriebenen Assoziation des V380 Allels mit sporadischem MP (Lucking et al., 2003). So zeigte ein Vergleich der Allelfrequenzen weder für die deutsche, noch für die norewegische Kohorte signifikante Unterschiede zwischen Patienten und Kontrollen (p=0,7 bzw. p=0,96). Darüber hinaus war das V380 Allel in unseren Studien sogar häufiger bei gesunden Kontrollen als bei Patienten vorhanden. Damit unterstützen unsere Daten die bereits mehrfach vermutete Hypothese einer fehlenden Assoziation von SNPs im Parkin Gen mit MP (Oliveira et al., 2003B). Eine nach Veröffentlichung unserer Ergebnisse erschienene Studie widerspricht ebenfalls einer Assoziation des V380 Allels mit MP und stützt so die von uns erhobenen Ergebnisse (Sun et al. 2006). 22 Diskussion 4.2 PINK1 als Kandidatengen für die Late-Onset Form des MP Ausschluss des PINK1 Gens als Kandidatengen für die Late-Onset Form des MP in zwei Populationen. Das komplette PINK1 Gen wurde bei 175 Late-Onset Patienten (90 norwegische Patienten, 85 deutsche Patienten) auf Sequenzvariationen untersucht. Dabei handelt es sich um die erste Mutationsanalyse des PINK1 Gens bei einer ausschließlich aus Late-Onset Patienten bestehenden Kohorte. Das Risiko, potentielle Mutationen zu übersehen, wurde durch eine gut etablierte und optimierte SSCP Analyse nach Standardverfahren minimiert (Jaeckel et al., 1998). Trotz intensiver Analyse wurden keinerlei pathogene Mutationen gefunden. Daher scheint es am wahrscheinlichsten, dass PINK1 Mutationen bei den hier untersuchten Late-Onset Patientenkohorte keine Rolle in der Pathogenese des MP spielen. Um die fehlende Relevanz des PINK1 Gens bei Late-Onset Patienten endgültig auszuschließen, sollten zukünftige Untersuchungen auch Promotor sowie enhancer/silencer Regionen auf Veränderungen überprüfen. Die Hypothese der geringen Relevanz des PINK1 Gens bei der Late-Onset Form des MP wird durch eine umfangreiche Untersuchung von Late-Onset und Early-Onset Patienten unterstützt, in der ebenso keiner der über 100 Late-Onset Patienten Veränderungen im PINK1 Gen zeigte (Rogaeva et al., 2004). Auch wenn Mutationen im PINK1 Gen bei den hier untersuchten Late-Onset Patienten keine Rolle spielen, gibt es dennoch Hinweise für eine Rolle des Proteins in der Pathogenese auch der sporadischen MP Formen: Erst kürzlich konnte in LBs sowohl von Mutationsträgern als auch Patienten mit sporadischem MP das PINK1 Protein nachgewiesen (Gandhi et al., 2006; Muqit et al., 2006B). Genotypisierung der exonischen Sequenzvariation Q115L. Für die Late-Onset Form des MP könnten neben pathogenen Mutationen auch bestimmte Polymorphismen als Suszeptibilitätsfaktoren fungieren und so die Krankheitsanfälligkeit, z.B. in Gegenwart von relevanten Umweltfaktoren erhöhen. Bei der Analyse des PINK1 Gens wurde unter anderem die erst kürzlich beschriebene exonische Sequenzvariation 23 Diskussion Q115L gefunden (Klein et al., 2005). Die Genotypisierung erfolgte mittels DHPLC in den norwegischen und deutschen Patientenkohorten sowie bei gesunden norwegischen bzw. deutschen Kontrollpersonen (136 bzw. 210 Personen). Die beobachteten Frequenzen zeigten keine signifikanten Unterschiede, weder für die deutsche (p=0,27), noch für die norwegische Kohorte (p=0,8). Eine Assoziation dieser Sequenzvariation mit MP kann somit für die beiden untersuchten Patientenkohorten ausgeschlossen werden. Diese Beobachtungen werden durch vorherige Untersuchungen weiterer kodierender SNPs im PINK1 Gen unterstützt, die ebenfalls keine Assoziation mit MP zeigten (Groen et al., 2004). Zu demselben Ergebnis kommt ebenfalls eine kürzlich erschienene Untersuchung in einer finnischen MP Kohorte (Clarimon et al., 2006). 4.3 Vergleich zwischen norwegischen und deutschen Patientenkohorten Die Analyse der beiden Gene PINK1 und Parkin wurde in zwei verschiedenen Kohorten durchgeführt und anschließend verglichen. Die Norwegische Kohorte wurde im Umkreis von Stavanger im Westen von Norwegen rekrutiert und bereits in mehreren klinischen MP Studien beschrieben (Kurz et al., 2003; Tandberg et al., 1995). Diese norwegische Population geht aus einer kleinen Gründerpopulation hervor und ist für ihre genetische Homogenität bekannt (Borg et al., 1999). Die deutsche Kohorte wurde im St. Josef Hospital Bochum im Ruhrgebiet zusammengestellt. Diese Kohorte repräsentiert eine typische urbane Population eines Ballungsgebiets und ist durch hohe genetische Heterogenität gekennzeichnet. Vergleich der SNP Frequenzen. Der Vergleich der SNP Frequenzen zwischen den beiden Populationen zeigte signifikante Frequenzunterschiede (p<0,05) für SNPs im PINK1 Gen (L63L, Ivs45A>G, Ivs6+43C>T). Auch im Parkin Gen konnten signifikante Frequenzunterschiede beobachtet werden (Ivs2+25T>C, Ivs2+35G>A, Ivs3-20T>C, Ivs7-35G>A und Ivs8+48C>T). Einige SNPs waren dabei 24 Diskussion deutlich häufiger in der deutschen Kohorte vorhanden [Ivs2+25T>C (p=0,015), Ivs7-35G>A (p=0,013) und Ivs8+48C>T (p=0,029)]. Vergleich der Auftrittsfrequenzen von Parkin Mutationen. Parkin Mutationen im heterozygoten Zustand wurden sowohl im norwegischen, als auch im deutschen Patientenkollektiv gefunden. Die Frequenz des mutierten Alleles in der norwegischen Kohorte war dabei deutlich niedriger als in der deutschen Kohorte (0,5% versus 1,6%). Dieser Unterschied erscheint beachtlich, da beide Analysen unter exakt gleichen Bedingungen durchgeführt wurden. Es ist nicht ganz auszuschließen, dass die unterschiedlichen Allelfrequenzen auf das höhere durchschnittliche Erkrankungsalter der norwegischen Patienten zurückzuführen ist (63.6 Jahre versus 55.2 Jahre in der deutschen Kohorte). Am wahrscheinlichsten ist jedoch, dass unsere Daten auf eine unterschiedliche Relevanz von Parkin Mutationen in den beiden Populationen hinweisen. 4.4 Rolle des LRRK2 Gens bei deutschen MP Patienten Auftrittsfrequenzen von LRRK2 Mutationen bei deutschen MP Patienten. Eine Kohorte bestehend aus 120 deutschen MP Patienten wurde auf Mutationen in neun Exons des LRRK2 Gens untersucht. Dabei wurden bei drei Patienten putativ pathogene Mutationen gefunden. Die Ergebnisse sprechen für eine Rolle von LRRK2 Mutationen bei der Pathogenese des MP in der deutschen Bevölkerung. In der durchgeführten Untersuchung zeigten 2,5% aller untersuchten Patienten putativ pathogene Mutationen im LRRK2 Gen (G2019S, A1151T). Da mit 9 von 51 Exons nur ein kleiner Teil des gesamten Gens untersucht wurde, ist der Anteil von MP Patienten mit LRRK2 Mutationen wahrscheinlich noch wesentlich höher. 6,7% aller Patienten mit einer positiven Familienanamnese, jedoch nur 1,1 % aller Patienten mit einer negativen Familienanamnese sind Mutationsträger. Das größte Risiko für eine LRRK2 Mutation zeigten in unserer Studie Patienten, die an der EarlyOnset Form des MP leiden: zwei von insgesamt zehn Patienten sind 25 Diskussion Träger einer LRRK2 Mutation, unter den Late-Onset Patienten hingegen nur 1 von 110. Um diese beobachtete Tendenz zu bestätigen, sind allerdings Untersuchungen in größeren Kohorten notwendig. Charakterisierung der neuen Mutation A1151T. Die bisher unbeschriebene Mutation A1151T wurde bei einer Patientin mit der klassischen Late-Onset Form des MP identifiziert. Bei erstmals beschriebenen Mutationen stellt sich zunächst die Frage nach ihrem Krankheitswert. Die mögliche Pathogenität der Mutation A1151T im LRRK2 Gen wird durch mehrere Hinweise gestützt. Erste Hinweise gibt der fehlende Nachweis bei 168 gesunden Kontrollpersonen. Des Weiteren liegt die Mutation in der LRR-kodierenden Region des Gens, der eine Rolle bei Protein Protein Interaktion zugeschrieben wird (Kobe und Kajava, 2001). Homologievergleiche mit unterschiedlichen Spezies zeigen, dass das betroffene Alanin an Position 1151 sowie die umgebenden Aminosäuren konserviert sind und deuten so auf eine funktionelle Bedeutung hin (Abbildung 4.1). Die Patientin erkrankte im Alter von 55 Jahren an einseitigem Tremor der linken Hand und Akinese. Nach einem mittlerweile 10 Jährigen Krankheitsverlauf zeigt die Patientin jetzt deutliche Komplikationen der L-Dopa Therapie im Sinne von On-off Fluktuationen sowie eine milde mentale Beeinträchtigung. Die Mutter der Patientin verstarb im Alter von 68 Jahren, der Vater mit 30 Jahren. Beide zeigten keinerlei Symptome des MP. Daher bleibt es unklar, ob die Mutation mit unvollständiger Penetranz einhergeht, de novo entstand oder ob die Eltern vor Manifestation der Erkrankung verstarben. 26 Diskussion 1 2527 AS LRR ROC COR MAPKKK WD40 A1151T (Exon 25) 1138 1169 Mensch NHISSLSENFLEACPKVESFSARMNFLAAMP Ratte NHIPSLPEDFLEACPKVESFSARMNFLAAMP Maus NHIPSLPGDFLEACSKVESFSARMNFLAAMP Canis NHITSLAEDFFEACPKVESFSAR I NYLAAMP Abbildung 4.1. Struktur des LRRK2 Proteins mit den funktionellen Domänen. Die Abbildung zeigt die Position der hier neu beschriebenen Mutation A1151T (Exon 25) in der LRR Domäne und die Konservierung des Alanins bei verschiedenen Spezies. Charakterisierung der häufigen Mutation G2019S. Bei zwei Patienten wurde die häufige Mutation G2019S gefunden. Ein Mutationsträger deutscher Herkunft leidet an typischem MP der Early-Onset Form mit gutem Ansprechen auf L-Dopa. Er erkrankte im Alter von 45 Jahren mit asymmetrischem Tremor. Nach anamnestischen Angaben des Sohnes litt auch der Vater des Patienten an einem Tremor. Eine weiterführende neurologische und molekulargenetische Untersuchung des Vaters war leider nicht möglich. Eine weitere Mutationsträgerin weißrussischer Herkunft erkrankte im Alter von 30 Jahren an von Akinese und Rigor dominiertem MP (siehe Abbildung 4.2, IV.1). Außer dem frühen Erkrankungsalter zeigte die Patientin keine weiteren atypischen Befunde. Interessanterweise berichtete die Familie, dass auch die Urgroßmutter der Mutationsträgerin (I.1) im Alter von etwa 70 an tremordominantem MP erkrankte. Da die Urgroßmutter jedoch schon vor vielen Jahren verstarb, war nur eine Untersuchung ihrer beiden Töchter (III.1 und III.2) möglich. Die Tante der Indexpatientin (III.1) zeigte weder die Mutation, noch Anzeichen eines MP. Bei der Mutter der Indexpatientin (III.2) hingegen wurde die Mutation G2019S in heterozygotem Zustand gefunden. Bei 27 Diskussion einer ausführlichen neurologischen Untersuchung zeigte die 68 jährige Frau allerdings keinerlei Anzeichen eines MP. Damit zählte diese Frau zum Zeitpunkt der Veröffentlichung zu den bisher ältesten beschriebenen gesunden Mutationsträgern. Der Stammbaum der beschriebenen Familie (Abbildung 4.2) wirft die Frage auf, ob die Mutation inkomplette oder altersabhängige Penetranz aufweist. Eine Hypothese geht von einer altersabhängigen Penetranz aus (Kachergus et al., 2005), die durch Umwelt- und/oder genetische Faktoren getriggert werden könnte. Die Hypothese modifizierender Umweltfaktoren wird durch die Identifizierung eines monozygoten Zwillingspaares mit der G2019S Mutation unterstützt. Ein Zwilling war im Alter von 38 Jahren erkrankt, der andere Zwilling mit 62 Jahren neurologisch (noch) unauffällig (Singleton et al., 2005). Während zum Zeitpunkt der Veröffentlichung keine funktionellen Untersuchungen der häufigen Mutation G2019S vorlagen, wurde in Untersuchungen mittlerweile nachgewiesen, dass die Mutation G2019S zur erhöhten Kinaseaktivität des LRRK2 Proteins führt (West et al. 2005). Bei Versuchen mit Inhibitoren der Kinaseaktivität wurde außerdem gezeigt, dass diese den Zelltod verzögern und die Bildung von Einschlusskörperchen verhindern. Diese Beobachtungen legen eine therapeutische Nutzung von Inhibitoren der Kinaseaktivität bei Patienten mit LRRK2 Mutationen und eventuell bei Patienten mit sporadischem MP nahe (Greggio et al., 2006). Sollte sich eine solche therapeutische Nutzung von Inhibitoren der Kinaseaktivität etablieren lassen, könnte die Mutter der Indexpatientin (III.2) davon profitieren, da sie als asymptomatische Mutationsträgerin als Risikoperson für die Entwicklung eines MP einzustufen ist. 28 Diskussion I. I.1 ErkrankungsBeginn: Late-Onset II.1 II. 82 J. III. III.1 72 J. IV. * III.2 68 J. * IV.1 Erkrankungs- * beginn: 30 J. V. Abbildung 4.2. Stammbaum einer Familie mit der G2019S Mutation. Römische Ziffern bezeichnen die Generation, arabische Zahlen die einzelnen Individuen der Generation; an MP erkrankte Mitglieder sind grau unterlegt, Mutationsträger der G2019S Mutation im LRRK2 Gen schraffiert dargestellt. Der Stern markiert Personen, die molekulargenetisch auf die Mutation untersucht wurden. 29 Zusammenfassung und Ausblick 5 Zusammenfassung und Ausblick Mit der hier vorliegenden Arbeit konnte gezeigt werden, dass ein - wenn auch kleiner - Anteil von Patienten mit MP Mutationen in den bisher bekannten Kandidatengenen Parkin und LRRK2 vorweist. Dabei scheinen insbesondere Mutationen im LRRK2 Gen sowie Mutationen im heterozygoten Zustand im Parkin Gen bei Patienten mit der Late-Onset Form relevant zu sein. Mutationen im LRRK2 Gen betreffen dabei sowohl Early- als auch Late-Onset Patienten, sind jedoch tendenziell häufiger bei Patienten mit der Early-Onset Form zu finden. Das PINK1 Gen hingegen scheint keine Rolle bei der Pathogenese der Late-Onset Form zu spielen. Die Hypothese, dass auch Mutationen im heterozygoten Zustand, insbesondere des Parkin Gens, pathogene Auswirkungen haben können, findet vermehrt Unterstützung (Beffert und Rosenberg, 2006). Dabei stößt das klassische Konzept der autosomal-rezessiven Vererbung z.B. für das Parkin Gen an seine Grenzen. Vielmehr scheint es sich um einen Dosisabhängigen Effekt zu handeln, bei dem schon Mutationen im heterozygoten Zustand pathogene Effekte haben, wenn auch mildere als bei einer homozygoten Ausprägung (Sun et al., 2006). Dies erklärt die Beobachtung, dass heterozygote Mutationsträger insbesondere unter den Late-Onset Patienten zu finden sind. PET Untersuchungen von gesunden Mutationsträgern mit Mutationen im heterozygoten Zustand im Parkin ebenso wie im PINK1 Gen zeigen subklinisch dopaminerge Dysfunktion (Khan et al, 2002; Khan et al., 2005). Wenn diese Risikopersonen zusätzlich noch Triggerfaktoren wie z.B. Umweltgiften ausgesetzt werden, sind sie wahrscheinlich eher anfällig, MP zu entwickeln. Die Hypothese, dass genetische Veränderungen und Umweltfaktoren gemeinsam die Manifestation eines MP auslösen, scheint insbesondere für Mutationen im LRRK2 Gen zuzutreffen. Kenntnisse aus der genetischen Parkinsonforschung haben maßgeblich dazu geführt, die Pathogenese des MP besser zu verstehen. In der jetzigen Situation stellen sich weiterführende Aufgaben, insbesondere für die neuen Kandidatengene (z.B. das LRRK2 Gen) müssen Genotyp, Phänotyp und Penetranz der unterschiedlichen Mutationen bestimmt 30 Zusammenfassung und Ausblick werden (Klein, 2006). Erkenntnisse aus größeren Familien mit LRRK2 Mutationen (siehe Abbildung 4.2; Schlitter et al., 2006B) sind essentiell, um das individuelle Risiko von Mutationsträgern abzuschätzen und adäquate genetische Beratung zu ermöglichen. Da für MP zum jetzigen Zeitpunkt lediglich symptomatische jedoch keine präventiven Therapieoptionen zur Verfügung stehen (Poewe, 2006), haben genetische Tests als Mittel zur Frühdiagnostik im Moment noch keinen großen klinischen Stellenwert und sollten überlegt eingesetzt werden. Diese restriktive Strategie könnte sich ändern, sobald neuroprotektive Medikamente zur Verfügung stehen würden. Dann könnten bei positivem Testergebnis einer erkrankten Indexperson weitere asymptomatische Familienmitglieder auf Mutation im betreffenden Gen untersuch werden. So identifizierte Risikopersonen würden dann von neuroprotektiven Medikamenten profitieren. Wissenschaftlich bedeutsam ist ein neuer Aspekt, der Parkin und PINK1 verbindet, die beiden Gene mit der höchsten Mutationsrate bei autosomalrezessiv vererbtem MP. Das Parkin Produkt ist ein Enzym des UPS, das PINK1 Protein eine Kinase mit mitochondrialer Lokalisation. Jetzt gibt es Hinweise, dass beide Gene auch einen gemeinsamen Signalweg mit Einfluss auf die Funktion der Mitochondrien haben und sogar miteinander agieren (Clark et al., 2006; Pallanck und Greenamyre, 2006; Park et al., 2006). Im Drosophila Tiermodell führt ein Verlust des PINK1 Gens unter anderem zu männlicher Sterilität, apoptotischer Muskeldegeneration sowie erhöhter Anfälligkeit gegenüber oxidativem Stress (Clark et al., 2006). Ein Funktionsverlust des Parkin Gens zeigt ähnliche Effekte, so auch Veränderungen der Mitochondrien (Greene et al., 2003; Pesah et al., 2004; Park et al., 2006), die nicht allein durch Dysfunktion des UPS erklärt werden können. Da Verluste des PINK1 Gens interessanterweise durch Überexpression des Parkin Gens ausgeglichen werden können, geht man mittlerweile von einem gemeinsamen Signalweg beider Gene aus, bei dem das PINK1 Genprodukt oberhalb desjenigen des Parkin Gens agiert (Clark et al., 2006). Diese neuen Erkenntnisse unterstützen die These, dass mitochondriale Dysfunktion eine, wenn nicht die zentrale Rolle in der Pathogenese des MP spielt. 31 Literaturverzeichnis 6 Literaturverzeichnis Adams, J.R., van Netten, H., Schulzer, M., Mak, E., Mckenzie, J., Strongosky, A., Sossi, V., Ruth, T.J., Lee, C.S., Farrer, M., Gasser, T., Uitti, R.J., Calne, D.B., Wszolek, Z.K., Stoessl, A.J. (2005). PET in LRRK2 mutations: comparison to sporadic Parkinson's disease and evidence for presymptomatic compensation. Brain 128, 2777-85. Autere, J.M., Moilanen, J.S., Myllyla, V.V., Majamaa, K. (2000). Familial aggregation of Parkinson's disease in a Finnish population. J Neurol Neurosurg Psychiatry 69, 107-9. Bataille, V. (1999). The role of twin studies in the genetics of skin diseases. Clin Exp Dermatol 24, 286-90. Beal, M.F. (2003) Mitochondria, oxidative damage, and inflammation in Parkinson's disease. Ann N Y Acad Sci 991, 120-31. Beffert, U., Rosenberg, R.N. (2006). Increased risk for heterozygotes in recessive Parkinson disease. Arch Neurol 63, 807-8. Bentivoglio, A.R., Cortelli, P., Valente, E.M., Ialongo, T., Ferraris, A., Elia, A., Montagna, P., Albanese, A. (2001). Phenotypic characterisation of autosomal recessive PARK6-linked parkinsonism in three unrelated Italian families. Mov Disord 16, 999-1006. Bertoli-Avella, A.M., Giroud-Benitez, J.L., Akyol, A., Barbosa, E., Schaap, O., van der Linde, H.C., Martignoni, E., Lopiano, L., Lamberti, P., Fincati, E., Antonini, A., Stocchi, F., Montagna, P., Squitieri, F., Marini, P., Abbruzzese, G., Fabbrini, G., Marconi, R., Dalla Libera, A., Trianni, G., Guidi, M., De Gaetano, A., Boff Maegawa, G., De Leo, A., Gallai, V., de Rosa, G., Vanacore, N., Meco, G., van Duijn, C.M., Oostra, B.A., Heutink, P., Bonifati, V.; Italian Parkinson Genetics Network. (2005). Novel parkin mutations detected in patients with early-onset Parkinson's disease. Mov Disord 20, 424-31. Bonifati, V., Rizzu, P., van Baren, M.J., Schaap, O., Breedveld, G.J., Krieger, E., Dekker, M,C., Squitieri, F., Ibanez, P., Joosse, M., van Dongen, J.W., Vanacore, N., van Swieten, J.C., Brice, A., Meco, G., van Duijn, C.M., Oostra, B.A., Heutink, P. (2003). Mutations in the DJ-1 gene associated with autosomal recessive early-onset parkinsonism. Science 299, 256-9. Borg, A., Dorum, A., Heimdal, K., Maehle, L., Hovig, E., Moller, P. (1999). BRCA1 1675delA and 1135insA account for one third of Norwegian familial breast-ovarian cancer and are associated with later disease onset than less frequent mutations. Dis Markers 15, 79-84. Bosgraaf, L., Van Haastert, P.J. (2003). Roc, a Ras/GTPase domain in complex proteins. Biochim Biophys Acta. 1643, 5-10. 32 Literaturverzeichnis Braak, H., Del Tredici, K., Rub, U., de Vos, R.A., Jansen Steur, E.N., Braak, E. (2003). Staging of brain pathology related to sporadic Parkinson's disease. Neurobiol Aging 24, 197-211. Brice, A. (2005). Genetics of Parkinson's disease: LRRK2 on the rise. Brain 128, 2760-2. Brown, T.P., Rumsby, P.C., Capleton, A.C., Rushton, L., Levy, L.S. (2006). Pesticides and Parkinson's disease--is there a link? Environ Health Perspect 114, 156-64. Burn, D.J., Mark, M.H., Playford, E.D., Maraganore, D.M., Zimmerman, T.R., Duvoisin, R.C., Harding, A.E., Marsden, C.D., Brooks, D.J. (1992). Parkinson's disease in twins studied with 18F-dopa and positron emission tomography. Neurolog 42, 1894-1900. Chartier-Harlin, M.C., Kachergus, J., Roumier, C., Mouroux, V., Douay, X., Lincoln, S., Levecque, C., Larvor, L., Andrieux, J., Hulihan, M., Waucquier, N., Defebvre, L., Amouyel, P., Farrer, M., Destee, A. (2004). Alphasynuclein locus duplication as a cause of familial Parkinson's disease. Lancet. 364, 1167-9. Clarimon, J., Eerola, J., Hellstrom, O., Peuralinna, T., Tienari, P.J., Singleton, A.B. (2006). Assessment of PINK1 (PARK6) polymorphisms in Finnish PD. Neurobiol Aging 27, 906-7. Clark, I.E., Dodson, M.W., Jiang, C., Cao, J.H., Huh, J.R., Seol, J.H., Yoo, S.J., Hay, B.A., Guo, M. (2006). Drosophila pink1 is required for mitochondrial function and interacts genetically with parkin. Nature 441, 1162-6. Cookson, M.R., Lockhart, P.J., McLendon, C., O'Farrell, C., Schlossmacher, M., Farrer, M.J. (2003). RING finger 1 mutations in Parkin produce altered localization of the protein. Hum Mol Genet 12, 2957-65. Dauer, W., Przedborski, S. (2003). Parkinson's disease: mechanisms and models. Neuron 39, 889-909. De Rijk, M.C., Launer, L.J., Berger, K., Breteler, M.M., Dartigues, J.F., Baldereschi, M., Fratiglioni, L., Lobo, A., Martinez-Lage, J., Trenkwalder, C., Hofman, A. (2000). Prevalence of Parkinson's disease in Europe: A collaborative study of population-based cohorts. Neurologic Diseases in the Elderly Research Group. Neurology 54, S21-3. Di Fonzo, A, Rohe, C.F., Ferreira, J., Chien, H.F., Vacca, L., Stocchi, F., Guedes, L., Fabrizio, E., Manfredi, M., Vanacore, N., Goldwurm, S., Breedveld, G., Sampaio, C., Meco, G., Barbosa, E., Oostra, B.A., Bonifati, V., Italian Parkinson Genetics Network. (2005). A frequent LRRK2 gene mutation associated with autosomal dominant Parkinson's disease. Lancet 365, 412-5. 33 Literaturverzeichnis Djarmati A, Hedrich K, Svetel M, Lohnau T, Schwinger E, Romac S, Pramstaller PP, Kostic V, Klein C. Heterozygous PINK1 mutations: A susceptibility factor for Parkinson disease? Mov Disord. 2006 Jun 5; [Epub ahead of print] Duvoisin, R.C., Eldridge, R., Williams, A., Nutt, J., Calne, D. (1981) Twin study of Parkinson disease. Neurology 31, 77-80. Elbaz, A., Grigoletto, F., Baldereschi, M., Breteler, M.M., ManubensBertran, J.M., Lopez-Pousa, S., Dartigues, J.F., Alperovitch, A., Tzourio, C., Rocca, W.A. (1999). Familial aggregation of Parkinson's disease: a population-based case-control study in Europe. EUROPARKINSON Study Group. Neurology 52, 1876-82. Fahn, S. (2003). Description of Parkinson's disease as a clinical syndrome. Ann N Y Acad Sci 991, 1-14. Foroud, T., Uniacke, S.K., Liu, L., Pankratz, N., Rudolph, A., Halter, C., Shults, C., Marder, K., Conneally, P.M., Nichols, W.C., Parkinson Study Group. (2003). Heterozygosity for a mutation in the parkin gene leads to later onset Parkinson disease. Neurology 60, 796-801. Funayama, M., Hasegawa, K., Kowa, H., Saito, M., Tsuji, S., Obata, F. (2002). A new locus for Parkinson's disease (PARK8) maps to chromosome 12p11.2-q13.1. Ann Neurol 51, 296-301. Funayama, M., Hasegawa, K., Ohta, E., Kawashima, N., Komiyama, M., Kowa, H., Tsuji, S., Obata, F. (2005). An LRRK2 mutation as a cause for the parkinsonism in the original PARK8 family. Ann Neurol 57, 918-21. Gandhi, S., Muqit, M.M., Stanyer, L., Healy, D.G., Abou-Sleiman, P.M., Hargreaves, I., Heales, S., Ganguly, M., Parsons, L., Lees, A.J., Latchman, D.S., Holton, J.L., Wood, N.W., Revesz, T. (2006). PINK1 protein in normal human brain and Parkinson's disease. Brain 129, 1720-31. Gasser, T., Muller-Myhsok, B., Wszolek, Z.K., Oehlmann, R., Calne, D.B., Bonifati, V., Bereznai, B., Fabrizio, E., Vieregge, P., Horstmann, R.D. (1998). A susceptibility locus for Parkinson's disease maps to chromosome 2p13. Nat Genet 18, 262-5. Gary, D.S., Mattson, M.P. (2002). PTEN regulates Akt kinase activity in hippocampal neurons and increases their sensitivity to glutamate and apoptosis. Neuromolecular Med 2, :261-9. Giasson, B.I., Covy, J.P., Bonini, N.M., Hurtig, H.I., Farrer, M.J., Trojanowski, J.Q., Van Deerlin, V.M. (2006). Biochemical and pathological characterization of Lrrk2. Ann Neurol 59, 315-22. Gilks, W.P., Abou-Sleiman, P.M., Gandhi, S., Jain, S., Singleton, A., Lees, A.J., Shaw, K., Bhatia, K.P., Bonifati, V., Quinn, N.P., Lynch, J., Healy, 34 Literaturverzeichnis D.G., Holton, J.L., Revesz, T., Wood, N.W. (2005). A common LRRK2 mutation in idiopathic Parkinson's disease. Lancet 365, 415-6. Goldwurm, S., Zini, M., Di Fonzo, A., De Gaspari, D., Siri, C., Simons, E.J., van Doeselaar, M., Tesei, S., Antonini, A., Canesi, M., Zecchinelli, A., Mariani, C., Meucci, N., Sacilotto, G., Cilia, R., Isaias, I.U., Bonetti, A., Sironi, F., Ricca, S., Oostra, B.A., Bonifati, V., Pezzoli, G. (2006). LRRK2 G2019S mutation and Parkinson's disease: A clinical, neuropsychological and neuropsychiatric study in a large Italian sample. Parkinsonism Relat Disord. Jun 2; [Epub ahead of print] Greene, J.C., Whitworth, A.J., Kuo, I., Andrews, L.A., Feany, M.B., Pallanck, L.J. (2003). Mitochondrial pathology and apoptotic muscle degeneration in Drosophila parkin mutants. Proc Natl Acad Sci U S A 100, 4078-83. Greggio, E., Jain, S., Kingsbury, A., Bandopadhyay, R., Lewis, P., Kaganovich, A., van der Brug, M.P., Beilina, A., Blackinton, J., Thomas, K.J., Ahmad, R., Miller, D.W., Kesavapany, S., Singleton, A., Lees, A., Harvey, R.J., Harvey, K., Cookson, M.R. (2006). Kinase activity is required for the toxic effects of mutant LRRK2/dardarin. Neurobiol Dis 23, 329-41. Groen, J.L., Kawarai, T., Toulina, A., Rivoiro, C., Salehi-Rad, S., Sato, C., Morgan, A., Liang, Y., Postuma, R.B., St George-Hyslop, P., Lang, A.E., Rogaeva, E. (2004). Genetic association study of PINK1 coding polymorphisms in Parkinson's disease. Neurosci Lett 372, 226-9. Hampshire, D.J., Roberts, E., Crow, Y., Bond, J., Mubaidin, A., Wriekat, A.L., Al-Din, A., Woods, C.G. (2001). Kufor-Rakeb syndrome, pallidopyramidal degeneration with supranuclear upgaze paresis and dementia, maps to 1p36. J Med Genet 38, 680-2. Hatano, Y., Li, Y., Sato, K., Asakawa, S., Yamamura, Y., Tomiyama, H., Yoshino, H., Asahina, M., Kobayashi, S., Hassin-Baer, S., Lu, C.S., Ng, A.R., Rosales, R.L., Shimizu, N., Toda, T., Mizuno, Y., Hattori, N. (2004). Novel PINK1 mutations in early-onset parkinsonism. Ann Neurol 56, 424-7. Healy, D.G., Abou-Sleiman, P.M., Ahmadi, K.R., Muqit, M.M., Bhatia, K.P., Quinn, N.P., Lees, A.J., Latchmann, D.S., Goldstein, D.B., Wood, N.W. (2004). The gene responsible for PARK6 Parkinson's disease, PINK1, does not influence common forms of parkinsonism. Ann Neurol 56, 329-35. Hedrich, K., Eskelson, C., Wilmot, B., Marder. K., Harris, J., Garrels, J., Meija-Santana, H., Vieregge, P., Jacobs, H., Bressman, S.B., Lang, A.E., Kann, M., Abbruzzese, G., Martinelli, P., Schwinger, E., Ozelius, L.J., Pramstaller, P.P., Klein, C., Kramer, P. (2004). Distribution, type, and origin of Parkin mutations: review and case studies. Mov Disord 19, 114657. Hedrich, K., Hagenah, J., Djarmati, A., Hiller, A., Lohnau, T., Lasek, K., Grunewald, A., Hilker, R., Steinlechner, S., Boston, H., Kock, N., 35 Literaturverzeichnis Schneider-Gold, C., Kress, W., Siebner, H., Binkofski, F., Lencer, R., Munchau, A., Klein, C. (2006). Clinical spectrum of homozygous and heterozygous PINK1 mutations in a large German family with Parkinson disease: role of a single hit? Arch Neurol 63, 833-8. Hernandez, D.G., Paisan-Ruiz, C., McInerney-Leo, A., Jain, S., MeyerLindenberg, A., Evans, E.W., Berman, K.F., Johnson, J., Auburger, G., Schaffer, A.A., Lopez, G.J., Nussbaum, R.L., Singleton, A.B. (2005). Clinical and positron emission tomography of Parkinson's disease caused by LRRK2. Ann Neurol 57, 453-6. Hicks, A.A., Petursson, H., Jonsson, T., Stefansson, H., Johannsdottir, H.S., Sainz, J., Frigge, M.L., Kong, A., Gulcher, J.R., Stefansson, K., Sveinbjornsdottir, S. (2002). A susceptibility gene for late-onset idiopathic Parkinson's disease. Ann Neurol 52, 549-55. Jaeckel, S., Epplen, J.T., Kauth, M., Miterski, B., Tschentscher, F., Epplen, C. (1998). Polymerase chain reaction-single strand conformation polymorphism or how to detect reliably and efficiently each sequence variation in many samples and many genes. Electrophoresis 19, 3055-61. Jenner, P. (2003). Oxidative stress in Parkinson's disease. Ann Neurol 53 ,S26-36. Kachergus, J., Mata, I.F., Hulihan, M., Taylor, J.P., Lincoln, S., Aasly, J., Gibson, J.M., Ross, O.A., Lynch, T., Wiley, J., Payami, H., Nutt, J., Maraganore, D.M., Czyzewski, K., Styczynska, M., Wszolek, Z.K., Farrer, M.J., Toft, M. (2005). Identification of a novel LRRK2 mutation linked to autosomal dominant parkinsonism: evidence of a common founder across European populations. Am J Hum Genet 76, 672-80. Kay, D.M., Kramer, P., Higgins, D., Zabetian, C.P., Payami, H. (2005). Escaping Parkinson's disease: a neurologically healthy octogenarian with the LRRK2 G2019S mutation. Mov Disord 20, 1077-8. Khan, N.L., Valente, E.M., Bentivoglio, A.R., Wood, N.W., Albanese, A., Brooks, D.J., Piccini, P. (2002). Clinical and subclinical dopaminergic dysfunction in PARK6-linked parkinsonism: an 18F-dopa PET study. Ann Neurol 52, 849-53. Khan, N.L., Scherfler, C., Graham, E., Bhatia, K.P., Quinn, N., Lees, A.J., Brooks, D.J., Wood, N.W., Piccini, P. (2005). Dopaminergic dysfunction in unrelated, asymptomatic carriers of a single parkin mutation. Neurology 64, 134-6. Kitada, T., Asakawa, S., Hattori, N., Matsumine, H., Yamamura, Y., Minoshima, S., Yokochi, M., Mizuno, Y., Shimizu, N. (1998). Mutations in the parkin gene cause autosomal recessive juvenile parkinsonism. Nature 392, 605-8. Klein, C., Djarmati, A., Hedrich, K., Schafer, N., Scaglione, C., Marchese, R., Kock, N., Schule, B., Hiller, A., Lohnau, T., Winkler, S., Wiegers, K., 36 Literaturverzeichnis Hering, R., Bauer, P., Riess, O., Abbruzzese, G., Martinelli, P., Pramstaller, P.P. (2005). PINK1, Parkin, and DJ-1 mutations in Italian patients with early-onset parkinsonism. Eur J Hum Genet 13, 1086-93. Klein, C. Implications of genetics on the diagnosis and care of patients with Parkinson disease. (2006). Arch Neurol 63, 328-34. Kobe, B., Kajava, A. V. (2001). The leucine-rich repeat as a protein recognition motif. Curr Opin Struct Biol 11, 725-32. Kurz, M., Alves, G., Aarsland, D., Larsen, J.P. (2003). Familial Parkinson's disease: a community-based study. Eur J Neurol 10, 159-63. Laihinen, A., Ruottinen, H., Rinne, J.O., Haaparanta, M., Bergman, J., Solin, O., Koskenvuo, M., Marttila, R., Rinne, U.K. (2000). Risk for Parkinson's disease: twin studies for the detection of asymptomatic subjects using [18F]6-fluorodopa PET. J Neurol 247, Suppl 2:II110-3. Lazzarini, A.M., Myers, R.H., Zimmerman, T.R. Jr, Mark, M.H., Golbe, L.I., Sage, J.I., Johnson, W.G., Duvoisin, R.C. (1994). A clinical genetic study of Parkinson's disease: evidence for dominant transmission. Neurology 44, 499-506. Lesage, S., Leutenegger, A.L., Ibanez, P., Janin, S., Lohmann, E., Durr, A., Brice, A., French Parkinson's Disease Genetics Study Group. (2005). LRRK2 haplotype analyses in European and North African families with Parkinson disease: a common founder for the G2019S mutation dating from the 13th century. Am J Hum Genet 77, 330-2. Leroy, E., Boyer, R., Auburger, G., Leube, B., Ulm, G., Mezey, E., Harta, G., Brownstein, M.J., Jonnalagada, S., Chernova, T., Dehejia, A., Lavedan, C., Gasser, T., Steinbach, P.J., Wilkinson, K.D., Polymeropoulos, M.H. (1998). The ubiquitin pathway in Parkinson's disease. Nature 395, 451-2. Lucking, C.B., Durr, A., Bonifati, V., Vaughan, J., De Michele, G., Gasser, T., Harhangi, B.S., Meco, G., Denefle, P., Wood, N.W., Agid, Y., Brice, A., French Parkinson's Disease Genetics Study Group; European Consortium on Genetic Susceptibility in Parkinson's Disease. (2000). Association between early-onset Parkinson's disease and mutations in the parkin gene. N Engl J Med 342, 1560-7. Lucking, C.B., Chesneau, V., Lohmann, E., Verpillat, P., Dulac, C., Bonnet, A.M., Gasparini, F., Agid, Y., Durr, A., Brice, A. (2003). Coding polymorphisms in the parkin gene and susceptibility to Parkinson disease. Arch Neurol 60, 1253-6. Mata, I.F., Kachergus, J.M., Taylor, J.P., Lincoln, S., Aasly, J., Lynch, T., Hulihan, M.M., Cobb, S.A., Wu, R.M., Lu, C.S., Lahoz, C., Wszolek, Z.K., Farrer, M.J. (2005). Lrrk2 pathogenic substitutions in Parkinson's disease. Neurogenetics 6, 171-7. 37 Literaturverzeichnis Marsden, C.D. (1983). Neuromelanin and Parkinson's disease. J Neural Transm Suppl 19:121-41. Marsden, C.D. (1987). Parkinson's disease in twins. J Neurol Neurosurg Psychiatry 50, 105-6. Marttila, R.J., Kaprio, J., Koskenvuo, M., Rinne, U.K. (1988). Parkinson's disease in a nationwide twin cohort. Neurology 38, 1217-9. Marx, J. Cell biology. (2002). Ubiquitin lives up to its name. Science 297, 1792-4. Mata, I.F., Wedemeyer, W.J., Farrer, M.J., Taylor, J.P., Gallo, K.A. (2006). LRRK2 in Parkinson's disease: protein domains and functional insights. Trends Neurosci 29, 286-93. McNaught, K.S., Perl, D.P., Brownell, A.L., Olanow, C.W. (2004). Systemic exposure to proteasome inhibitors causes a progressive model of Parkinson's disease. Ann Neurol 56, 149-62. McNaught, K.S., Jackson, T., JnoBaptiste, R., Kapustin, A., Olanow, C.W. (2006). Proteasomal dysfunction in sporadic Parkinson's disease. Neurology 66, S37-49. Muqit, M.M., Gandhi, S., Wood, N.W. (2006A). Mitochondria in Parkinson disease: back in fashion with a little help from genetics. Arch Neurol 63, 649-54. Muqit, M.M., Abou-Sleiman, P.M., Saurin, A.T., Harvey, K., Gandhi, S., Deas, E., Eaton, S., Payne Smith, M.D., Venner, K., Matilla, A., Healy, D.G., Gilks, W.P., Lees, A.J., Holton, J., Revesz, T., Parker, P.J., Harvey, R.J., Wood, N.W., Latchman, D.S. (2006B). Altered cleavage and localization of PINK1 to aggresomes in the presence of proteasomal stress. J Neurochem 98, 156-69. Nichols, W.C., Pankratz, N., Hernandez, D., Paisan-Ruiz, C., Jain, S., Halter, C.A., Michaels, V.E., Reed, T., Rudolph, A., Shults, C.W., Singleton, A., Foroud, T., Parkinson Study Group-PROGENI investigators. (2005). Genetic screening for a single common LRRK2 mutation in familial Parkinson's disease. Lancet 365, 410-2. Oliveira, S.A., Scott, W.K., Martin, E.R., Nance, M.A., Watts, R.L., Hubble, J.P., Koller, W.C., Pahwa, R., Stern, M.B., Hiner, B.C., Ondo, W.G., Allen, F.H. Jr, Scott, B.L., Goetz, C.G., Small, G.W., Mastaglia, F., Stajich, J.M., Zhang, F., Booze, M.W., Winn, M.P., Middleton, L.T., Haines, J.L., Pericak-Vance, M.A., Vance, J.M. (2003A). Parkin mutations and susceptibility alleles in late-onset Parkinson's disease. Ann Neurol 53, 624-9. Oliveira, S.A., Scott, W.K., Nance, M.A., Watts, R.L., Hubble, J.P., Koller, W.C., Lyons, K,E,, Pahwa, R., Stern, M.B., Hiner, B.C., Jankovic, J., Ondo, W.G., Allen, F.H. Jr, Scott, B.L., Goetz, C.G., Small, G.W., Mastaglia, F.L., 38 Literaturverzeichnis Stajich, J.M., Zhang, F., Booze, M.W., Reaves, J.A., Middleton, L.T., Haines, J.L., Pericak-Vance, M.A., Vance, J.M., Martin, E.R. (2003B). Association study of Parkin gene polymorphisms with idiopathic Parkinson disease. Arch Neurol 60, 975-80. Paisan-Ruiz, C., Jain, S., Evans, E.W., Gilks, W.P., Simon, J., van der Brug, M., Lopez de Munain, A., Aparicio, S., Gil, A.M., Khan, N., Johnson, J., Martinez, J.R., Nicholl, D., Carrera, I.M., Pena, A.S., de Silva, R., Lees, A., Marti-Masso, J.F., Perez-Tur, J., Wood, N.W., Singleton, A.B. (2004). Cloning of the gene containing mutations that cause PARK8-linked Parkinson's disease. Neuron 44, 595-600. Pallanck, L., Greenamyre, J.T. (2006). Neurodegenerative disease: pink, parkin and the brain. Nature 441, 1058. Pankratz, N., Nichols, W.C., Uniacke, S.K., Halter, C., Murrell, J., Rudolph, A., Shults, C,W., Conneally, P.M., Foroud, T., Parkinson Study Group. (2003A). Genome-wide linkage analysis and evidence of gene-by-gene interactions in a sample of 362 multiplex Parkinson disease families. Hum Mol Genet 12, 2599-608. Pankratz, N., Nichols, W.C., Uniacke, S.K., Halter, C., Rudolph, A., Shults, C., Conneally, P.M., Foroud, T., Parkinson Study Group. (2003B). Significant linkage of Parkinson disease to chromosome 2q36-37. Am J Hum Genet 72, 1053-7. Park, J., Lee, S.B., Lee, S., Kim, Y., Song, S., Kim, S., Bae, E., Kim, J., Shong, M., Kim, J.M., Chung, J. (2006). Mitochondrial dysfunction in Drosophila PINK1 mutants is complemented by parkin. Nature 441, 115761. Parkinson, J. (1817). An Essay on the Shaking Palsy. Sherwood, Neely, and Jones. London. Payami, H., Larsen, K., Bernard, S., Nutt, J. (1994). Increased risk of Parkinson's disease in parents and siblings of patients. Ann Neurol 36, 659-61. Periquet, M., Latouche, M., Lohmann, E., Rawal, N., De Michele, G., Ricard, S., Teive, H., Fraix, V., Vidailhet, M., Nicholl, D., Barone, P., Wood, N.W., Raskin, S., Deleuze, J.F., Agid, Y., Durr, A., Brice, A., French Parkinson's Disease Genetics Study Group; European Consortium on Genetic Susceptibility in Parkinson's Disease. (2003). Parkin mutations are frequent in patients with isolated early-onset parkinsonism. Brain 126, 1271-8. Pesah, Y., Pham, T., Burgess, H., Middlebrooks, B., Verstreken, P., Zhou, Y., Harding, M., Bellen, H., Mardon, G. (2004). Drosophila parkin mutants have decreased mass and cell size and increased sensitivity to oxygen radical stress. Development 131, 2183-94. 39 Literaturverzeichnis Petit, A., Kawarai, T., Paitel, E., Sanjo, N., Maj, M., Scheid, M., Chen, F., Gu, Y., Hasegawa, H., Salehi-Rad, S., Wang, L., Rogaeva, E., Fraser, P., Robinson, B., St George-Hyslop, P., Tandon, A. (2005). Wild-type PINK1 prevents basal and induced neuronal apoptosis, a protective effect abrogated by Parkinson disease-related mutations. J Biol Chem 280, 34025-32. Piccini, P., Burn, D.J., Ceravolo, R., Maraganore, D., Brooks, D.J. (1999). The role of inheritance in sporadic Parkinson's disease: evidence from a longitudinal study of dopaminergic function in twins. Ann Neurol 45, 57782. Poewe, W. (2006). The need for neuroprotective therapies in Parkinson's disease: a clinical perspective. Neurology 66, S2-9. Polymeropoulos, M.H., Lavedan, C., Leroy, E., Ide, S.E., Dehejia, A., Dutra, A., Pike, B., Root, H., Rubenstein, J., Boyer, R., Stenroos, E.S., Chandrasekharappa, S., Athanassiadou, A., Papapetropoulos, T., Johnson, W.G., Lazzarini, A.M., Duvoisin, R.C., Di Iorio, G., Golbe, L.I., Nussbaum, R.L. (1997). Mutation in the alpha-synuclein gene identified in families with Parkinson's disease. Science 276, 2045-7. Priyadarshi, A., Khuder, S.A., Schaub, E.A., Shrivastava, S. (2000). A meta-analysis of Parkinson's disease and exposure to pesticides. Neurotoxicology 21, 435-40. Rogaeva, E., Johnson, J., Lang, A.E., Gulick, C., Gwinn-Hardy, K., Kawarai, T., Sato, C., Morgan, A., Werner, J., Nussbaum, R., Petit, A., Okun, M.S., McInerney, A., Mandel, R., Groen, J.L., Fernandez, H.H., Postuma, R., Foote, K.D., Salehi-Rad, S., Liang, Y., Reimsnider, S., Tandon, A., Hardy, J., St George-Hyslop, P., Singleton, A.B. (2004). Analysis of the PINK1 gene in a large cohort of cases with Parkinson disease. Arch Neurol 61, 1898-904. Schapira, A.H., Cooper, J.M., Dexter, D., Jenner, P., Clark, J.B., Marsden, C.D. (1989). Mitochondrial complex I deficiency in Parkinson's disease. Lancet 1, 1269. Schlitter, A.M., Kurz, M., Larsen, J.P., Woitalla, D., Mueller, T., Epplen, J.T., Dekomien, G. (2005). Exclusion of PINK1 as candidate gene for the late-onset form of Parkinson's disease in two European populations. J Negat Results Biomed 14, 4:10. Schlitter, A.M., Kurz, M., Larsen, J.P., Woitalla, D., Muller, T., Epplen, J.T., Dekomien, G. (2006A). Parkin gene variations in late-onset Parkinson's disease: comparison between Norwegian and German cohorts. Acta Neurol Scand 113, 9-13. Schlitter, A.M., Woitalla, D., Mueller, T., Epplen, J.T., Dekomien, G. (2006B). The LRRK2 gene in Parkinson's disease: mutation screening in patients from Germany. J Neurol Neurosurg Psychiatry 77, 891-2. 40 Literaturverzeichnis Scott, W.K., Grubber, J.M., Conneally, P.M., Small, G.W., Hulette, C.M., Rosenberg, C.K., Saunders, A.M., Roses, A.D., Haines, J.L., PericakVance, M.A. (2000). Fine mapping of the chromosome 12 late-onset Alzheimer disease locus: potential genetic and phenotypic heterogeneity. Am J Hum Genet 66, 922-32. Shen, J., Cookson, M.R. (2004). Mitochondria and dopamine: new insights into recessive parkinsonism. Neuron 43, 301-4. Shimura, H., Hattori, N., Kubo, S., Mizuno, Y., Asakawa, S., Minoshima, S., Shimizu, N., Iwai, K., Chiba, T., Tanaka, K., Suzuki, T. (2000). Familial Parkinson disease gene product, parkin, is a ubiquitin-protein ligase. Nat Genet 25, 302-5. Singleton, A.B., Farrer, M., Johnson, J., Singleton, A., Hague, S., Kachergus, J., Hulihan, M., Peuralinna, T., Dutra, A., Nussbaum, R., Lincoln, S., Crawley, A., Hanson, M., Maraganore, D., Adler, C., Cookson, M.R., Muenter, M., Baptista, M., Miller, D., Blancato, J., Hardy, J., GwinnHardy, K. (2003). alpha-Synuclein locus triplication causes Parkinson's disease. Science 302, 841. Singleton, A.B. (2005). Altered alpha-synuclein homeostasis causing Parkinson's disease: the potential roles of dardarin. Trends Neurosci 28, 416-21. Silvestri, L., Caputo, V., Bellacchio, E., Atorino L, Dallapiccola B, Valente EM, Casari G. (2005). Mitochondrial import and enzymatic activity of PINK1 mutants associated to recessive parkinsonism. Hum Mol Genet 14, 3477-92. Sun, M., Latourelle, J.C., Wooten, G.F., Lew, M.F., Klein, C., Shill, H.A., Golbe, L.I., Mark, M.H., Racette, B.A., Perlmutter, J.S., Parsian, A., Guttman, M., Nicholson, G., Xu, G., Wilk, J.B., Saint-Hilaire, M.H., DeStefano, A.L., Prakash, R., Williamson, S., Suchowersky, O., Labelle, N., Growdon, J.H., Singer, C., Watts, R.L., Goldwurm, S., Pezzoli, G., Baker, K.B., Pramstaller, P.P., Burn, D.J., Chinnery, P.F., Sherman, S., Vieregge, P., Litvan, I., Gillis, T., MacDonald, M.E., Myers, R.H., Gusella, J.F. (2006). Influence of heterozygosity for parkin mutation on onset age in familial Parkinson disease: the GenePD study. Arch Neurol 63, 826-32. Sveinbjornsdottir, S., Hicks, A.A., Jonsson, T., Petursson, H., Gugmundsson, G., Frigge, M.L., Kong, A., Gulcher, J.R., Stefansson, K. (2000). Familial aggregation of Parkinson's disease in Iceland. N Engl J Med 343, 1765-70. Tanaka, K., Suzuki, T., Chiba, T., Shimura, H., Hattori, N., Mizuno, Y. (2001). Parkin is linked to the ubiquitin pathway. J Mol Med 79, 482-94. Tandberg, E., Larsen, J.P., Nessler, E.G., Riise, T., Aarli, J.A. (1995). The epidemiology of Parkinson's disease in the county of Rogaland, Norway. Mov Disord 10, 541-9. 41 Literaturverzeichnis Tanner, C.M., Ottman, R., Goldman, S.M., Ellenberg, J., Chan, P., Mayeux, R., Langston, J.W. (1999). Parkinson disease in twins: an etiologic study. JAMA 281, 341-6. Toft, M., Sando, S.B., Melquist, S., Ross, O.A., White, L.R., Aasly, J.O., Farrer, M.J. (2005). LRRK2 mutations are not common in Alzheimer's disease. Mech Ageing Dev 126, 1201-5. Unoki, M., Nakamura, Y. (2001). Growth-suppressive effects of BPOZ and EGR2, two genes involved in the PTEN signaling pathway. Oncogene 20, 4457-65. Valente, E.M., Abou-Sleiman, P.M., Caputo, V., Muqit, M,M., Harvey, K., Gispert, S., Ali, Z., Del Turco, D., Bentivoglio, A.R., Healy, D.G., Albanese, A., Nussbaum, R., Gonzalez-Maldonado, R., Deller, T., Salvi, S., Cortelli, P., Gilks, W.P., Latchman, D.S., Harvey, R.J., Dallapiccola, B., Auburger, G., Wood, N.W. (2004). Hereditary early-onset Parkinson's disease caused by mutations in PINK1. Science 304, 1158-60. Van Duijn, C.M., Dekker, M.C., Bonifati, V., Galjaard, R.J., HouwingDuistermaat, J.J., Snijders, P.J., Testers, L., Breedveld, G.J., Horstink, M., Sandkuijl, L.A., van Swieten, J.C., Oostra, B.A., Heutink, P. (2001). Park7, a novel locus for autosomal recessive early-onset parkinsonism, on chromosome 1p36. Am J Hum Genet 69, 629-34. Vieregge, P., Hagenah, J., Heberlein, I., Klein, C., Ludin, H.P. (1999). Parkinson's disease in twins: a follow-up study. Neurology 53, 566-72. Von Coelln, R., Dawson, V.L., Dawson, T.M. (2004). Parkin-associated Parkinson's disease. Cell Tissue Res 318, 175-84. Ward, C.D., Duvoisin, R.C., Ince, S.E., Nutt, J.D., Eldridge, R., Calne, D.B., Dambrosia, J. (1984). Parkinson's disease in twins. Adv Neurol 40, 341-4. Warner, T.T., Schapira, A.H. (2003). Genetic and environmental factors in the cause of Parkinson's disease. Ann Neurol 53, S16-23. Weintraub, D., Stern, M.B. (2005). Psychiatric complications in Parkinson disease. Am J Geriatr Psychiatry 13, 844-51. West, A., Periquet, M., Lincoln, S., Lucking, C.B., Nicholl, D., Bonifati, V., Rawal, N., Gasser, T., Lohmann, E., Deleuze, J.F., Maraganore, D., Levey, A., Wood, N., Durr, A., Hardy, J., Brice, A., Farrer, M., French Parkinson's Disease Genetics Study Group and the European Consortium on Genetic Susceptibility on Parkinson's Disease. (2002). Complex relationship between Parkin mutations and Parkinson disease. Am J Med Genet 114, 584-91. West, A.B., Moore, D.J., Biskup, S., Bugayenko, A., Smith, W.W., Ross, C.A., Dawson, V.L., Dawson, T.M. (2005). Parkinson's disease-associated 42 Literaturverzeichnis mutations in leucine-rich repeat kinase 2 augment kinase activity. Proc Natl Acad Sci U S A 102, 16842-7. Wirdefeldt, K., Gatz, M., Schalling, M., Pedersen, N.L. (2004). No evidence for heritability of Parkinson disease in Swedish twins. Neurology 63, 305-11. Zabetian, C.P., Lauricella, C.J., Tsuang, D.W., Leverenz, J.B., Schellenberg, G.D., Payami, H. (2006). Analysis of the LRRK2 G2019S mutation in Alzheimer Disease. Arch Neurol 63, 156-7. Zimprich, A., Biskup, S., Leitner, P., Lichtner, P., Farrer, M., Lincoln, S., Kachergus, J., Hulihan, M., Uitti, R.J., Calne, D.B., Stoessl, A.J., Pfeiffer, R.F., Patenge, N., Carbajal, I.C., Vieregge, P., Asmus, F., Muller-Myhsok, B., Dickson, D.W., Meitinger, T., Strom, T.M., Wszolek, Z.K., Gasser, T. (2004). Mutations in LRRK2 cause autosomal-dominant parkinsonism with pleomorphic pathology. Neuron 44, 601-7. 43 Danksagung 7 Danksagung Mein besonderer Dank gilt …….. … Herrn Professor Dr. med. Jörg T. Epplen, meinem langjährigen Mentor und späteren Doktorvater, für die Bereitstellung des Themas, seine uneingeschränkte Unterstützung und Förderung, kritische Diskussion und wegweisende Kommentare. … Frau Dr. rer. nat. Gabriele Dekomien für die ausgezeichnete und persönliche Betreuung im Labor sowie die ständige Diskussionsbereitschaft. … Herrn Professor Dr. med. Thomas Müller und Herrn Dr. med. Martin Kurz für die ausgezeichnete und unkomplizierte Zusammenarbeit. … allen Mitgliedern des Instituts für Humangenetik für die tolle Hilfsbereitschaft und das gute Arbeitsklima. … Frau Dr. med. Elisabeth Petrasch-Parwez stellvertretend für alle Dozenten der medizinischen Fakultät der Ruhr-Universität Bochum, die stets Interesse an Ihren Studenten gezeigt haben und so das Studium bereichert haben. … der Heinrich und Alma Vogelsang Stiftung für das großzügige Promotionsstipendium. … von Herzen meinen Eltern für die Förderung meiner Interessen und Ideen und die Unterstützung meines Studiums. 44 Lebenslauf 8 Lebenslauf Anna Melissa Schlitter geboren am 13.01.1981 in Herdecke Schulische Ausbildung 1987 - 1991 Grundschulen Markstrasse und Neulingstrasse, Bochum 1991 - 2000 Gymnasium Hildegardisschule, Bochum Bilingualer Zweig mit Schwerpunkt Französisch 1997 Viermonatiger Auslandsschulaufendhalt Lycée Jeanne d´Arc, Clermont Ferrand, Frankreich 2000 Doppelabschluß: Abitur und Baccalauréat Universitäre Ausbildung 2000 - 2002 Vorklinisches Studium der Medizin an der Ruhr-Universität Bochum (Abschluß: Physikum) 2002 - 2003 Auslandsstudium im Rahmen der Deutsch-Französischen Hochschule an der Université Louis Pasteur, Strasbourg, Frankreich (Abschluß: 1. Staatsexamen) 2003 - 2006 2. Abschnitt des Klinischen Studiums an der Ruhr-Universität Bochum (Abschluß: 2. Staatsexamen) 2004 - 2006 Promotion in der Humangenetik bei Prof. Epplen, Ruhr-Universität Bochum Seit 2006 Praktisches Jahr an der Ruprecht-Karls-Universität Heidelberg (Abschluß: voraussichtlich 3. Staatsexamen) Stipendien 2002 - 2003 2005 - 2006 Auslandsstipendium der Deutsch-Französischen Hochschule Promotionsstipendium der Heinrich und Alma Vogelsang Stiftung Publikationen Schlitter, A.M., Kurz, M., Larsen, J.P., Woitalla, D., Mueller, T., Epplen, J.T., Dekomien, G. (2005). Exclusion of PINK1 as candidate gene for the late-onset form of Parkinson's disease in two European populations. J Negat Results Biomed 14, 4:10. Schlitter, A.M., Kurz, M., Larsen, J.P., Woitalla, D., Muller, T., Epplen, J.T., Dekomien, G. (2006A). Parkin gene variations in late-onset Parkinson's disease: comparison between Norwegian and German cohorts. Acta Neurol Scand 113, 9-13. Schlitter, A.M., Woitalla, D., Mueller, T., Epplen, J.T., Dekomien, G. (2006B). The LRRK2 gene in Parkinson's disease: mutation screening in patients from Germany. J Neurol Neurosurg Psychiatry 77, 891-2. Te Heesen, H., Schlitter, A.M., Schlitter, J. (2006). Empirical rules facilitate the search for binding sites on protein surfaces. J Mol Graph Model. May 12; [Epub ahead of print]. Kurz, M.W., Schlitter, A.M., Larsen, J.P., Ballard, C., Aarsland, D. Familial Occurrence of Dementia and Parkinsonism. A Systematic Review. (2006). Dement Geriatr Cogn Disord 22, 288-295. 45 Copyright Ó Blackwell Munksgaard 2005 Acta Neurol Scand 2006: 113: 9–13 DOI: 10.1111/j.1600-0404.2005.00532.x ACTA NEUROLOGICA SCANDINAVICA Parkin gene variations in late-onset Parkinson’s disease: comparison between Norwegian and German cohorts Schlitter AM, Kurz M, Larsen JP, Woitalla D, Müller T, Epplen JT, Dekomien G. Parkin gene variations in late-onset Parkinson’s disease: comparison between Norwegian and German cohorts. Acta Neurol Scand 2006: 113: 9–13. Ó Blackwell Munksgaard 2005. Objectives – Mutations in the Parkin gene can cause autosomal recessive early-onset Parkinson’s disease (PD). Recently, Parkin mutations were also suggested to play a role in the commoner lateonset forms of PD. Methods – We compared a German cohort of PD patients (95) with a Norwegian cohort of PD patients (96). Both cohorts have predominant late-onset form of PD. Mutation and polymorphism frequencies were compared via single-strand conformation polymorphism and sequence analyses. Results – Three heterozygous missense mutations (Arg256Cys, Arg402Cys and Thr240Met) were found in late-onset PD patients in the German patient cohort (1.6%). A missense mutation (Arg402Cys) was also found in one of 149 healthy control subjects (0.3%). Only one heterozygous missense mutation (Arg256Cys) was identified in a Norwegian patient suffering from late-onset PD (0.5%). The frequencies of four known single nucleotide polymorphisms significantly differ between the two distant European populations. Conclusion – The results support the hypothesis that heterozygous mutations in the Parkin gene may act as susceptibility alleles for late-onset forms of PD in rare cases. Introduction Mutations in the Parkin gene cause autosomal recessive early-onset Parkinson’s disease (PD) (1). The Parkin gene codes for an E3 ubiquitin-protein ligase involved in the ubiquitin-proteasome pathway. Parkin comprises two RING-finger motifs encoded in exons 7 and 11. The two RING-finger motifs and the region in between (RING1-IBRRING2) are necessary for non-covalent association with E2 ubiquitin-conjugating enzymes in the ubiquitin-proteasome pathway (2). Except for rare familial forms of PD caused by mutations in the alpha-synuclein (3), Parkin (1), UCHL-1 (4), PINK1 (5) and DJ-1 (6) gene, the genetic contribution to the pathogenesis of PD is still largely unclear. Recently, mutations in the LRRK2 gene, especially the mutation Gly2019Ser, were shown to cause autosomal dominantly transmitted PD in 1.6% of sporadic (7) and 2.8–6.6% of familial PD (8–10). Twin studies A. M. Schlitter1, M. Kurz2,3, J. P. Larsen3, D. Woitalla4, T. Müller4, J. T. Epplen1, G. Dekomien1 1 Department of Human Genetics, Ruhr-University Bochum, Bochum, Germany; 2Department of Neurology, Heinrich-Heine-University Düsseldorf, Dusseldorf, Germany; 3Department of Neurology, Stavanger University Hospital, Stavanger, Norway; 4Department of Neurology, St. Josef-Hospital, Ruhr-University Bochum, Bochum, Germany Key words: heterozygosity; late-onset Parkinson's disease; Norway; Parkin; susceptibility allele Gabriele Dekomien, Department of Human Genetics, Ruhr-University Bochum, 44780 Bochum, Germany Tel.: +49 234 322 5764 Fax: +49 234 321 4196 e-mail: [email protected] Accepted for publication September 21, 2005 seem to contradict hereditary theories for the most common late-onset forms of PD (11, 12). In contrast, previous studies on familial aggregation suggested a three- to fourfold increased risk in the families of PD patients (13–15). The higher risk for PD may result either from genetic susceptibility or shared environmental factors or, as generally favoured, from a complex interplay of both (16). A population-based study with genealogic data of the Icelandic population underlines the genetic component for the late-onset form as for the early-onset form of PD (17). Recently, strong evidence was reported for a possible role of Parkin gene variations in the late-onset form of PD (age of onset >45 years): Parkin mutations appear to contribute to the common late-onset form and mutations, especially heterozygous mutations in exon 7, may play a role as susceptibility alleles for sporadic PD (18). Significant association of the Val380 allele with sporadic PD was observed (19). In addition, 9 Schlitter et al. heterozygosity for mutations in the Parkin gene was shown to lead to later onset of PD (20). Based on these accumulated findings, we screened a Norwegian and a German cohort of patients with predominant late-onset PD for sequence exchanges in the Parkin gene. Table 1 Newly designed primers for Parkin gene analysis Exon Primer sequence Product size (bp) Ex 1 F: 5¢-CGGAAAGGGC-3¢ R 5¢-GCGGCGCAGAGAGGCTGTAC-3¢ R: 5¢-AGGCCATGCTCCATGCAGACTGC-3¢ 286 Ex 3 329 bp, Base pairs; F, forward primer; R, reverse primer; C, cytosine; G, guanosine; A, adenine; T, thymine. Materials and methods Patients and controls The Norwegian cohort consists of 96 patients suffering from predominant late-onset PD (median age of onset 63.6 years) originated from the Stavanger area of Western Norway. This population is known to be genetically quite homogeneous (21) and has previously been described in several clinical PD studies (15, 22). A positive family history of PD of first-degree relatives (parents and siblings) was documented in 17.7% of the patients. All patients meet the criteria for PD (15, 23) and were thoroughly clinically examined. An ethnically matched control group of healthy blood donors was recruited in Bergen, Norway. The German cohort consisted of 95 patients of the Ruhr area suffering from predominant late-onset PD (median age of onset 55.2 years) and was diagnosed according to the UK Brain Bank criteria (24). A positive PD family history of firstdegree relatives (parents and siblings) was documented in 16.5% of the patients. Ethnically matched control samples from healthy blood donors (mean age 43 years, range 19–69 years) were recruited at the neighbouring University Hospital of Essen (Germany). Population stratification was excluded for the controls by multiple microsatellites analyses. After receiving informed consent from the patients, peripheral blood samples were taken and genomic DNA was extracted following standard protocols (25). This study was approved by the German (Bochum and Düsseldorf) and Norwegian (Bergen) ethics committees. Molecular analyses The 12 coding exons of the Parkin gene (1) were amplified by polymerase chain reaction (PCR) in all patients using newly designed (Table 1) as well as established primer pairs (26). For each PCR reaction, a 10 l l reaction mix was set up containing 100 ng DNA, 1x GC buffer (Genecraft, Münster, Germany), 1 U Taq Polymerase (Genecraft), 0.2 mmol of each dNTP, 0.4 mmol of each primer and varying concentrations of MgCl2 (1–3 mmol; Genecraft). For single-strand conformation polymorphism (SSCP) analysis, 0.06 l l of [a32P] dCTP/ dATP (10 mCi/ml) was added. A touch-down 10 procedure in a thermocycler (Biometra, Goettingen, Germany) was applied: initial denaturation (3 min at 95°C), two initial cycles 6 and 3°C above the annealing temperature (50–55°C), 25–28 cycles of 95°C (30 s), annealing temperature (30 s), elongation at 72°C (30 s) and a final elongation step at 72°C (3 min). In order to optimize mutation screening by SSCP analysis, PCR products were digested with different restriction enzymes depending on the lengths of their fragments according to established procedure (27). Thereafter, SSCP analysis was used to identify mutations and single nucleotide polymorphisms (SNPs). For SSCP analysis, 3 l l of PCR product were mixed with 7 l l of loading puffer (95% deionized formamide, 10 mm NaOH, 20 mm EDTA, 0.06% xylene cyanol and 0.06% bromophenol blue) and heated for 5 min to 95°C before cooling on ice. Three microlitres of each mix was run on two sets of 6% polyacrylamide gels (one set containing 10% glycerol, another containing 5% glycerol and 1 m urea) with 1x TBE buffer at 55 W for 3–5 h at 4°C. Gels were dried and subjected to autoradiography over night. Selected samples with band shifts evidenced in SSCP analysis were confirmed by direct sequencing. The sequence reactions were run on an automated DNA sequencer (Applied Biosystems 377 XL, Foster City, CA, USA) using the Big Dye Terminator kit (BDT; Perkin-Elmer, Norwalk, CT, USA) and analysed with the ABI PrismTM 377XL collection and convenient sequencing analysis software. SNP and mutation frequencies in controls were determined by using specific restriction fragment length polymorphism and SSCP analyses. Statistical analyses Single nucleotide polymorphism frequencies were compared by the chi-squared test. P-values <0.05 was considered as significant. Results Mutations In the Parkin gene, altogether three previously described missense mutations (Thr240Met, Parkin gene variations in late-onset Parkinson’s disease Arg402Cys and Arg256Cys) were observed in our cohorts (Table 2). These mutations were present in patients with late-onset PD (Table 3). In the German cohort, we identified three different heterozygous mutations (Thr240Met, Arg256Cys and Arg402Cys) (1.6%), corresponding to a rate of 3.2% mutation carriers among the patients. This frequency is higher than previously described in Caucasian late-onset patients [Parkin mutations in 2% of all late-onset families screened (18)]. In control samples of 100 healthy blood donors, only the Arg402Cys mutation was identified in heterozygous state in one of 149 control samples of healthy German blood donors (0.3%; 44 years at time of testing). In the Norwegian patient cohort, we observed one heterozygous missense mutation (Arg256Cys) (0.5%; see Table 2). No mutation was detected in 100 healthy blood donors from Norway. Table 4 Parkin SNPs as identified in Norwegian (NW) and German (G) patient cohorts Polymorphisms T, thymine; C, cytosine; G, guanosine; A, adenine; Ala, alanine; Glu, glutamate; Ser, serine; Asn, asparagine; Val, valine; Leu, leucine; Asp, aspartate. Several intronic SNPs (IVS2 + 25T>C, IVS2 + 35G>A, IVS3-20T>C, IVS7-35G>A and IVS8 + 48C>T) were evident in both cohorts of patients (Table 4) with significant frequency differences. The SNPs IVS2 + 25T>C (P ¼ 0.015), IVS7-35G>A (P ¼ 0.013) and IVS8 + 48C>T (P ¼ 0.029) were more frequent in the German cohort. Exonic amino acid changes described previously as polymorphisms (Val380Leu, Ser167Asn and Asp394Asn) were more frequent in the German cohort, except for Ala82Glu as identified only in one Norwegian DNA sample. In the German cohort, we identified exchange Asp394Asn Table 2 Mutations identified in the Parkin gene in Norwegian (NW) and German (G) patient cohorts Exon Sequence variation (heterozygous state) Protein change NW cohort G cohort References 718C>T 867C>T 1204C>T Thr240Met Arg256Cys Arg402Cys 0 1 0 1 1 1 (20) (32) (33) 6 7 11 C, cytosine; T, thymine; Thr, threonine; Met, methionine; Arg, arginine; Cys, cysteine. Table 3 Patients with identified Parkin mutations Mutation (heterozygous state) Thr240Met Arg402Cys Arg256Cys Arg256Cys Patient ID Age of onset (years) Family history of PD PaMW 33 (Germany) PaMW 42 (Germany) PaMW 82 (Germany) PaN 26 (Norway) 52 65 Late-onset PD 53 No No No No Thr, threonine; Met, methionine; Arg, arginine; Cys, cysteine. Exon 2 2 2 3 4 4 4 8 8 8 8 10 10 10 11 Sequence variation (heterozygous stateA, homozygous stateB) IVS2 + 25T>CA IVS2 + 25T>CB IVS2 + 35G>AA IVS2 + 25T>CA 346C>AA IVS3-20T>CA IVS3-20T>CB 601G>AA IVS7-35G>AA IVS7-35G>AB IVS8 + 48C>TA IVS8 + 48C>TB 1237G>CA 1237G>CB 1113 G>AA 1281G>AA Protein change Ala82Glu Ser167Asn Val 380Leu Leu380 No protein change Asp394Asn NW cohort (%) G cohort (%) 23.9 4.2 1 37.6 7.5 1 1 0 9.4 0 3.1 12.5 6.25 9.4 10.8 0 1 0 1 18.9 4.2 3.2 0 24.1 0 20.9 36.8 1 0 1 in one individual and Ser167Asn in three samples, all of them in heterozygous state. These two SNPs were not identified in the Norwegian cohort. The Ser167Asn polymorphism only occurred in combination with the intronic polymorphism in homozygous state IVS3-20T>C. The Val380 allele was significantly more frequent (P ¼ 0.0081) in the Norwegian cohort. The frequency of Val380Leu polymorphism differed not between patients (including sporadic and familial PD) and controls, neither for the German (P ¼ 0.43, 147 controls) nor for the Norwegian (P ¼ 0.74, 112 controls) cohorts. Following the study design of Lucking et al. (19), we also compared the frequency of the Val380 allele between patients with sporadic PD and healthy controls. Significant differences were not observed between patients with sporadic PD and controls, neither for the German (P ¼ 0.7) nor for the Norwegian (P ¼ 0.96) cohorts. Discussion We report here on the analysis of the Parkin gene in a cohort of PD patients from Western Norway, known as a relatively isolated population with limited genetic heterogeneity (21). This cohort was compared with a German cohort of PD patients. Four heterozygous mutations were identified, one in the Norwegian cohort (0.5%), three in the German cohort (1.6%). The results support the hypothesis that heterozygous mutations in the Parkin gene may act as susceptibility alleles in rare cases (18, 20). These data do not suggest a 11 Schlitter et al. major role of point mutations in the Parkin gene for the pathogenesis of late-onset PD. Missense mutation Arg402Cys was also found in one control individual (44 years at time of testing) in heterozygous state (0.3%). Although the blood donor was healthy at the moment of testing, later manifestation of PD (estimated prevalence 0.02%) cannot be excluded. The missense mutation Arg256Cys found in both cohorts is situated in the first RING finger domain. The RING finger interacts with E2 ubiquitin-conjugating enzymes like UbcH7 (2) in the ubiquitin-proteasome system. Missense mutation Arg256Cys leads to cytoplasmic and nuclear inclusion, which may participate in the pathogenetic mechanism (28). Similar findings of Arg256Cys in our different cohorts and the knowledge of the pathogenetic mechanism support the hypothesis that especially heterozygous mutations residing in exon 7 might act as susceptibility alleles in late-onset PD (18). In the Norwegian cohort, the number of mutations was threefold lower (0.5% vs 1.6%). Taking into account that both mutation screens were performed under exactly the same conditions, this difference is remarkable. We cannot exclude that higher age of onset in the Norwegian cohort (median age of onset 63.6 years vs 55.2 years) relates to the reduced value of mutations found. Nevertheless, our data suggest differential relevance of Parkin mutations in the German and the Norwegian cohorts. In spite of extensive screening, we only identified heterozygous mutations, a fact that cannot easily be reconciled with autosomal recessively transmitted PD. The chance of missing potential mutations and SNPs by SSCP analysis was minimized by following optimized protocols according to established procedures (27). Yet, our findings are consistent with previously published data of affected cases with only one mutated allele (18, 20, 26). Several authors have proposed haploinsufficiency as model for the observation of disease-associated heterozygous mutations (18, 29) and they suspect oxidative stress to lead to manifestation of haploinsufficiency (29). Interestingly, this model complies with the hypothesis of synergistic influence of genetic and environmental factors to the development of PD. Despite the hypothesis that Parkin mutations (in heterozygous state) contribute to the pathogenesis of the common form of PD, their exact role remains unclear. Asymptomatic carriers of a single Parkin mutation were shown to have nigrostriatal dysfunction and subtle extrapyramidal signs that did not fulfil criteria for PD (30). Confirmation whether these cases go on to develop PD and further case studies of parents 12 from PD patients with homozygous Parkin mutations (i.e. heterozygous mutation carriers) could help to elucidate the role of these mutations in pathogenesis of PD. Our data do not support the hypothesis of a significant association of the Val380 allele with sporadic PD (19). No association was observed, neither in the German (P ¼ 0.7) nor in the Norwegian (P ¼ 0.96) cohort. Furthermore, the Val380 allele was even more frequent in healthy controls compared with patient cohorts. Our data support the repeatedly formulated hypothesis (31) of a lacking association between any polymorphism of the Parkin gene and the pathogenesis of PD. In conclusion, the results support the hypothesis that mutations in the Parkin gene in heterozygous state may act as susceptibility alleles for late-onset form of PD in rare cases. Acknowledgements We sincerely thank all subjects for participation in this study and Dr O.-B. Tysnes (Department of Neurology, Haukeland University Hospital, Bergen, Norway) for providing control samples. A.M.S. gratefully acknowledges an Alma and Heinrich Vogelsang Foundation fellowship. References 1. Kitada T, Asakawa S, Hattori N et al. Mutations in the parkin gene cause autosomal recessive juvenile parkinsonism. Nature 1998;392:605–8. 2. Shimura H, Hattori N, Kubo S et al. Familial Parkinson disease gene product, parkin, is a ubiquitin-protein ligase. Nat Genet 2000;25:302–5. 3. Polymeropoulos MH LC, Leroy E, Ide SE et al. Mutation in the alpha-synuclein gene identified in families with Parkinson’s disease. Science 1997;276:2045–7. 4. Leroy E, Boyer R, Auburger G et al. The ubiquitin pathway in Parkinson’s disease. Nature 1998;395:451–2. 5. Valente EM, Abou-Sleiman PM, Caputo V et al. Hereditary early-onset Parkinson’s disease caused by mutations in PINK1. Science 2004;304:1158–60. 6. Bonifati V, Rizzu P, Squitieri F et al. DJ-1(PARK7), a novel gene for autosomal recessive, early onset parkinsonism. Neurol Sci 2003;24:159–60. 7. Gilks WP, Abou-Sleiman PM, Gandhi S et al. A common LRRK2 mutation in idiopathic Parkinson’s disease. Lancet 2005;365:415–6. 8. Kachergus J, Mata IF, Hulihan M et al. Identification of a novel LRRK2 mutation linked to autosomal dominant parkinsonism: evidence of a common founder across European populations. Am J Hum Genet 2005;76:672–80. 9. Di Fonzo A, Rohe CF, Ferreira J et al. A frequent LRRK2 gene mutation associated with autosomal dominant Parkinson’s disease. Lancet 2005;365:412–5. 10. Nichols WC, Pankratz N, Hernandez D et al. Genetic screening for a single common LRRK2 mutation in familial Parkinson’s disease. Lancet 2005;365:410–2. 11. Duvoisin RC, Eldridge R, Williams A, Nutt J, Calne D. Twin study of Parkinson disease. Neurology 1981;31:77–80. Parkin gene variations in late-onset Parkinson’s disease 12. Tanner CM, Ottman R, Goldman SM et al. Parkinson disease in twins: an etiologic study. JAMA 1999;281:341–6. 13. Payami H, Larsen K, Bernard S, Nutt J. Increased risk of Parkinson’s disease in parents and siblings of patients. Ann Neurol 1994;36:659–61. 14. Autere JM, Moilanen JS, Myllyla VV, Majamaa K. Familial aggregation of Parkinson’s disease in a Finnish population. J Neurol Neurosurg Psychiatry 2000;69:107–9. 15. Kurz M, Alves G, Aarsland D, Larsen JP. Familial Parkinson’s disease: a community-based study. Eur J Neurol 2003;10:159–63. 16. Warner TT, Schapira AH. Genetic and environmental factors in the cause of Parkinson’s disease. Ann Neurol 2003;53:16–23. 17. Sveinbjornsdottir S, Hicks AA, Jonsson T et al. Familial aggregation of Parkinson’s disease in Iceland. N Engl J Med 2000;343:1765–70. 18. Oliveira SA, Scott WK, Martin ER et al. Parkin mutations and susceptibility alleles in late-onset Parkinson’s disease. Ann Neurol 2003;53:624–9. 19. Lucking CB, Chesneau V, Lohmann E et al. Coding polymorphisms in the parkin gene and susceptibility to Parkinson disease. Arch Neurol 2003;60:1253–6. 20. Foroud T, Uniacke SK, Liu L et al. Heterozygosity for a mutation in the parkin gene leads to later onset Parkinson disease. Neurology 2003;60:796–801. 21. Borg A, Dorum A, Heimdal K, Maehle L, Hovig E, Moller P. BRCA1 1675delA and 1135insA account for one third of Norwegian familial breast-ovarian cancer and are associated with later disease onset than less frequent mutations. Dis Markers 1999;15:79–84. 22. Tandberg E, Larsen JP, Nessler EG, Riise T, Aarli JA. The epidemiology of Parkinson’s disease in the county of Rogaland, Norway. Mov Disord 1995;10:541–9. 23. Larsen JP, Dupont E, Tandberg E. Clinical diagnosis of Parkinson’s disease. Proposal of diagnostic subgroups classified at different levels of confidence. Acta Neurol Scand 1994;89:242–51. 24. Hughes AJ, Daniel SE, Kilford L, Lees AJ. Accuracy of clinical diagnosis of idiopathic Parkinson’s disease: a clinico-pathological study of 100 cases. J Neurol Neurosurg Psychiatry 1992;55:181–4. 25. Miller SA, Dykes DD, Polesky HF. A simple salting out procedure for extracting DNA from human nucleated cells. Nucleic Acids Res 1988;16:1215. 26. West A, Periquet M, Lincoln S et al. Complex relationship between Parkin mutations and Parkinson disease. Am J Med Genet 2002;114:584–91. 27. Jaeckel S, Epplen JT, Kauth M, Miterski B, Tschentscher F, Epplen C. Polymerase chain reaction-single strand conformation polymorphism or how to detect reliably and efficiently each sequence variation in many samples and many genes. Electrophoresis 1998;19:3055–61. 28. Cookson MR, Lockhart PJ, McLendon C, O’Farrell C, Schlossmacher M, Farrer MJ. RING finger 1 mutations in Parkin produce altered localization of the protein. Hum Mol Genet 2003;12:2957–65. 29. von Coelln R, Dawson VL, Dawson TM. Parkin-associated Parkinson’s disease. Cell Tissue Res 2004;318:175–84. 30. Khan NL, Scherfler C, Graham E et al. Dopaminergic dysfunction in unrelated, asymptomatic carriers of a single parkin mutation. Neurology 2005;64:134–6. 31. Oliveira SA, Scott WK, Nance MA et al. Association study of Parkin gene polymorphisms with idiopathic Parkinson disease. Arch Neurol 2003;60:975–80. 32. Abbas N, Lucking CB, Ricard S et al. A wide variety of mutations in the parkin gene are responsible for autosomal recessive parkinsonism in Europe. French Parkinson’s Disease Genetics Study Group and the European Consortium on Genetic Susceptibility in Parkinson’s Disease. Hum Mol Genet 1999;8:567–74. 33. Bertoli-Avella A, Giroud-Benitez J, Akyol A et al. Novel parkin mutations detected in patients with early-onset Parkinson’s disease. Mov Disord 2004;20:424–31. 13 Journal of Negative Results in BioMedicine BioMed Central Open Access Research Exclusion of PINK1 as candidate gene for the late-onset form of Parkinson's disease in two European populations Anna Melissa Schlitter*1, Martin Kurz2,3, Jan P Larsen3, Dirk Woitalla4, Thomas Mueller4, Joerg T Epplen1 and Gabriele Dekomien1 Address: 1Department of Human Genetics, Ruhr-University Bochum, Germany, 2Department of Neurology, Heinrich-Heine-University Düsseldorf, Germany, 3Department of Neurology, Stavanger University Hospital, Norway and 4Department of Neurology, St. Josef-Hospital, RuhrUniversity Bochum, Germany Email: Anna Melissa Schlitter* - [email protected]; Martin Kurz - [email protected]; Jan P Larsen - [email protected]; Dirk Woitalla - [email protected]; Thomas Mueller - [email protected]; Joerg T Epplen - [email protected]; Gabriele Dekomien - [email protected] * Corresponding author Published: 14 December 2005 Journal of Negative Results in BioMedicine 2005, 4:10 doi:10.1186/1477-5751-4-10 Received: 10 July 2005 Accepted: 14 December 2005 This article is available from: http://www.jnrbm.com/content/4/1/10 © 2005 Schlitter et al; licensee BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Abstract Background: Parkinson's disease (PD) is the second most common neurodegenerative disorder. Recently, mutations in the PINK1 (PARK6) gene were shown to rarely cause autosomal-recessively transmitted, early-onset parkinsonism. In order to evaluate whether PINK1 contributes to the risk of common late-onset PD we analysed PINK1 sequence variations. A German (85 patients) and a Norwegian cohort (90 patients) suffering from late-onset PD were screened for mutations and single nucleotide polymorphisms (SNPs) in the PINK1 gene. Both cohorts consist of wellcharacterized patients presenting a positive family history of PD in ~17%. Investigations were performed by single strand conformation polymorphism (SSCP), denaturating high performance liquid chromatography (DHPLC) and sequencing analyses. SNP frequencies were compared by the χ2 test Results: Several common SNPs were identified in our cohorts, including a recently identified coding variant (Q115L) in exon 1. Genotyping of the Q115L variation did not reveal significant frequency differences between patients and controls. Pathogenic mutations in the PINK1 gene were not identified, neither in the German nor in the Norwegian cohort. Conclusion: Sequence variation in the PINK1 gene appears to play a marginal quantitative role in the pathogenesis of the late-onset form of PD, in German and Norwegian cohorts, if at all. Background PD is the second most common neurodegenerative disorder after Alzheimer disease affecting more than 1% of the population by the age of 65 years. Mutations in the alphasynuclein (PARK1), Parkin (PARK2) and DJ-1 (PARK7) gene cause fairly rare familial forms of PD characterized by an early age of onset. Mutations in the recently identi- fied LRRK2 (PARK8) gene, especially the common mutation G2019S, occur more frequently in patients suffering from early as well as late-onset PD [1,2]. Recently, mutations in the PINK1 (PARK6) gene were shown to cause autosomal recessively transmitted early-onset parkinsonism [3,4]. The PINK1 (PTEN-induced kinase 1) gene encodes a putative protein kinase. The protein is targeted Page 1 of 4 (page number not for citation purposes) Journal of Negative Results in BioMedicine 2005, 4:10 http://www.jnrbm.com/content/4/1/10 Table 1: Allelic frequencies of identified SNPs in Norwegian (NW) and German (G) patient cohorts Exon 1 1 5 6 8 8 Sequence variation Allelic frequencies Q115L L63L Ivs4-5A>G Ivs6+43C>T N521T c.1783A>T p-value *distribution is significant NW G 0.072 0.083 0.017 0.041 0.128 0.201 0.035 0.218 0.091 0.102 0.188 0.2 to mitochondria and shows a serine-threonine kinase domain with homology to kinases of the Ca2+/calmodulin family[3]. It appears to exert protective effects against cellular stress within mitochondria[3]. These findings link mitochondria directly to the pathogenesis of PD [3,5]. An additional link between mitochondrial dysfunction and PD is obvious via the identification of disease causing mutations in the Omi/HtrA2 gene [6]. The hypothesis of mitochondrial impairment was further emphasized by postmortem studies of PD brains [7] and observation of PD syndromes after intoxication with mitochondrial complex I inhibitors, such as MPTP (1-methyl-4-phenyl1,2,3,6-tetrahydropyridine) and rotenone [8]. Mutations in the PINK1 gene are the second most common cause of autosomal-recessively inherited early-onset PD after mutations in the Parkin gene. On the other hand, strong evidence was reported for a possible role of Parkin gene variations in the late-onset form of PD (age of onset >45 years): Parkin mutations appear to contribute to the common late-onset form and mutations, especially in exon 7 in heterozygous state, may play a role as susceptibility alleles for sporadic PD[9,10]. The question arises as to whether the PINK1 gene is also a candidate gene for lateonset forms of Parkinson's disease, similar to the suggested role of the Parkin gene. 0.13 0.0004 * 0.002 * 0.029 * 0.13 0.98 Results All 8 coding exons of the PINK1 gene were screened for sequence variation using SSCP and sequencing analyses. Several SNPs were identified in our cohorts (L63L, Q115L, Ivs4-5A>G het, Ivs6+43C>T het, N521T, c.1783A>T). Allelic frequencies of several SNPs differed significantly between the two European cohorts confirming homogeneity of the Norwegian cohort (Table 1). Patients and controls were genotyped for the recently identified variation Q115L [12] using DHPLC analysis (Table 2). The observed frequencies did not differ significantly between patients and controls, neither in the German (p = 0.27) nor in the Norwegian cohort (p = 0.8). This screening did not reveal any disease-relevant mutation in our cohorts. Discussion As recently shown, mutations in the PINK1 gene rarely cause autosomal-recessively transmitted PD [3]. Besides an early age of onset, the observed clinical symptoms in PD caused by PINK1 are similar to symptoms in idiopathic PD. In this population-based study, we investigated whether sequence variations in the PINK1 gene play a role in the late-onset form of PD. A recently described variation (Q115L) of the PINK1 gene [12] was identified in the German and the Norwegian cohorts. We calculated allele frequencies in cases and controls and show here that the Q115L variant was not associated with late-onset PD in our study. These findings correspond to previously published data of no leading association of other coding SNPs within the PINK1 gene and PD [13]. In addition, several common SNPs were identified. We did not find any path- Here we report of a population-based analysis of sequence variations within the PINK1 gene. The German cohort includes 85 patients suffering from late-onset form of PD and represents a modern urban population with a genetic heterogeneity. In contrast, the Norwegian cohort represents a more homogeneous population [11] and includes 90 patients suffering from late-onset form of PD. Table 2: Genotyping of the Q115L variation Q115 (Wildtype) Q115L L115 Norwegian cohort Patients (n = 90) Controls (n = 136) p 80 7 3 118 18 0 0.8 German cohort Patients (n = 85) 79 6 0 Controls (n = 210) p 190 16 4 0.27 Page 2 of 4 (page number not for citation purposes) Journal of Negative Results in BioMedicine 2005, 4:10 Table 3: Primers for PINK1 gene analysis Exon Primer sequence Product size (bp) Ex 1 507 Ex 2 Ex 3 Ex 4 Ex 5 Ex 6 Ex 7 Ex 8 F 5'-AAGTTTGTTGTGACCGGCG-3' R 5'-CTTAGCTCCGTCCTCCGCT-3' F 5'-CCTTCCTAGGCTCCCTGGC-3' R 5'-AAGATGGGCATTTTGAGAACATCT-3' F 5'-GCTTACAAGGAACTTACCATTCTGC-3' R 5'-GTGCTGAGGACATAAGTGATGGAT-3' F 5'-GATGTATCAGCTCCAGGCCCT-3' R 5'-TATTCTTTCCAGGTGTTGTATCTGATG-3' F 5'-AAACGTATTGGGAGTCGTCGA-3' R 5'-CTCTAGTGCCCCTGGAGAGCT-3' F 5'-CGAGTCTCCTGCATTCAGTGG-3' R 5'-GACATAGCAGGGCCTCTCAGAG-3' F 5'-TCAGGTGATGTGCAGGACATG-3' R 5'-CAGAGGTTTCTACCCACACCG-3' F 5'-GGACCAGAGAAGGGAAGACCC-3' R 5'-TCACGACACAGAGGATGCCA-3' 387 240 286 266 265 358 410 ogenic mutation of the PINK1 in our cohorts composed of patients suffering from late-onset form of PD. The risk to miss potential mutations was minimized by a well established and optimized SSCP analyses. The most likely reason to explain the absence of mutations in our cohorts is the lack of influence of the PINK1 gene in the pathogenesis of late-onset PD. Individual tagging SNPs and tag-defined haplotypes in 500 PD patients likewise did not reveal associations with PD [14]. Future investigations should include screening of potential promoter as well as enhancer/silencer regions of the gene to finally exclude any lack of influence of PINK1 variation on PD manifestation. Yet, functional investigations of the PINK1 protein are necessary to identify potential interaction partners as candidates for additional mutation screening. Conclusion Investigations of other genes involved in the mitochondrial pathway of the PINK1 gene are necessary to evaluate the exact role of mitochondrial impairment for common forms of PD. http://www.jnrbm.com/content/4/1/10 tives (siblings or parents). All patients meet the criteria for PD [15,17] and were thoroughly clinically examined. An ethnically matched control group of healthy blood donors was recruited in Bergen, Norway. The German cohort (n = 85) consists of patients of the Ruhr area suffering from late-onset PD (median age of onset 58.7 years, range from 45 to 79 years, standard deviation 8.7) diagnosed according to the UK Brain Bank criteria [18]. 16.5% of the patients presented a positive family history for PD concerning first degree relatives (siblings or parents). Ethnically matched control samples from senior healthy blood donors (median age 57.2 years, range from 42 to 68 years, standard deviation 5.7) were recruited at the neighbouring University Hospital of Essen (Germany). Population stratification was excluded for the controls by multiple microsatellites analyses. After receiving informed consent from the patients, peripheral blood samples were taken and genomic DNA was extracted following standard protocols. German (Bochum and Düsseldorf) and Norwegian (Bergen) ethics committees approved this study. SSCP, DHPLC, sequencing The 8 coding exons of the PINK1 gene were amplified by polymerase chain reaction (PCR) in all patients using designed primer pairs adapted to the SSCP technique (Table 3). SSCP analysis according to standard procedure [19] was used to identify mutations and SNPs. In order to optimize mutation screening by SSCP analyses, PCR products were digested with different restriction enzymes depending on the lengths of their fragments [19] and screened in two different conditions. Selected samples with band shifts evidenced in SSCP analyses were confirmed by direct sequencing. The sequence reactions were run on an automated DNA sequencer (Applied Biosystems 377 XL, Foster City, USA) and analyzed with the ABI Prism™ 377 XL collection and convenient sequencing analysis software. SNP frequencies of the Q115L variation in patients and controls were determinated by using DHPLC analyses (WAVE® system, Cheshire, UK, using software Wavemaker 4.1) according to established procedures. Statistical analyses SNP frequencies were compared by the χ2 test. We considered P-values < 0.05 as significant. Materials and methods Patients and controls The Norwegian cohort (n = 90) consists of patients suffering from late-onset PD (median age of onset 64.4 years, range from 49 to 78 years, standard deviation 7.9) originated from the Stavanger area of Western Norway. This population is known to be genetically quite homogeneous [11] and has previously been described in several clinical PD studies [15,16]. 16.7% of the patients presented a positive family history for PD concerning first degree rela- Authors' contributions AMS carried out the molecular genetic studies, performed the statistical analysis and drafted the manuscript. MK participated in devising the study based on thoroughly clinical analysis of the patients. JPL supervised data collection and diagnosis of the Norwegian cohort. DW and TM provided the samples and performed clinical diagnostics of the German patient group. JTE conceived of the study, and participated in its design and coordination and Page 3 of 4 (page number not for citation purposes) Journal of Negative Results in BioMedicine 2005, 4:10 helped to draft the manuscript. GD supervised AMS, especially the molecular studies. All authors read and approved the final manuscript. Acknowledgements We sincerely thank all the participants in this study. We also thank Dr. O.B. Tysnes (Department of Neurology, Haukeland University Hospital, Bergen, Norway) for providing control samples. AMS gratefully acknowledges an Alma and Heinrich Vogelsang Foundation fellowship. References 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. Gilks WP, Abou-Sleiman PM, Gandhi S, Jain S, Singleton A, Lees AJ, Shaw K, Bhatia KP, Bonifati V, Quinn NP, Lynch J, Healy DG, Holton JL, Revesz T, Wood NW: A common LRRK2 mutation in idiopathic Parkinson's disease. Lancet 2005, 365:415-416. Di Fonzo A, Rohe CF, Ferreira J, Chien HF, Vacca L, Stocchi F, Guedes L, Fabrizio E, Manfredi M, Vanacore N, Goldwurm S, Breedveld G, Sampaio C, Meco G, Barbosa E, Oostra BA, Bonifati V: A frequent LRRK2 gene mutation associated with autosomal dominant Parkinson's disease. Lancet 2005, 365:412-415. Valente EM, Abou-Sleiman PM, Caputo V, Muqit MM, Harvey K, Gispert S, Ali Z, Del Turco D, Bentivoglio AR, Healy DG, Albanese A, Nussbaum R, Gonzalez-Maldonado R, Deller T, Salvi S, Cortelli P, Gilks WP, Latchman DS, Harvey RJ, Dallapiccola B, Auburger G, Wood NW: Hereditary early-onset Parkinson's disease caused by mutations in PINK1. Science 2004, 304:1158-1160. Rogaeva E, Johnson J, Lang AE, Gulick C, Gwinn-Hardy K, Kawarai T, Sato C, Morgan A, Werner J, Nussbaum R, Petit A, Okun MS, McInerney A, Mandel R, Groen JL, Fernandez HH, Postuma R, Foote KD, Salehi-Rad S, Liang Y, Reimsnider S, Tandon A, Hardy J, St GeorgeHyslop P, Singleton AB: Analysis of the PINK1 gene in a large cohort of cases with Parkinson disease. Arch Neurol 2004, 61:1898-1904. Shen J, Cookson MR: Mitochondria and dopamine: new insights into recessive parkinsonism. Neuron 2004, 43:301-304. Strauss KM, Martins LM, Plun-Favreau H, Marx FP, Kautzmann S, Berg D, Gasser T, Wszolek Z, Muller T, Bornemann A, Wolburg H, Downward J, Riess O, Schulz JB, Kruger R: Loss of function mutations in the gene encoding Omi/HtrA2 in Parkinson's disease. Hum Mol Genet 2005. Beal MF: Mitochondria, oxidative damage, and inflammation in Parkinson's disease. Ann N Y Acad Sci 2003, 991:120-131. Dauer W, Przedborski S: Parkinson's disease: mechanisms and models. Neuron 2003, 39:889-909. Foroud T, Uniacke SK, Liu L, Pankratz N, Rudolph A, Halter C, Shults C, Marder K, Conneally PM, Nichols WC, Parkinson Study G: Heterozygosity for a mutation in the parkin gene leads to later onset Parkinson disease. Neurology 2003, 60:796-801. Oliveira SA, Scott WK, Martin ER, Nance MA, Watts RL, Hubble JP, Koller WC, Pahwa R, Stern MB, Hiner BC, Ondo WG, Allen FHJ, Scott BL, Goetz CG, Small GW, Mastaglia F, Stajich JM, Zhang F, Booze MW, Winn MP, Middleton LT, Haines JL, Pericak-Vance MA, Vance JM: Parkin mutations and susceptibility alleles in lateonset Parkinson's disease.[see comment]. Annals of Neurology 2003, 53:624-629. Borg A DAHKMLHEMP: BRCA1 1675delA and 1135insA account for one third of Norwegian familial breast-ovarian cancer and are associated with later disease onset than less frequent mutations. Dis Markers 1999, Oct;15(1-3):79-84.:. Klein C, Djarmati A, Hedrich K, Schafer N, Scaglione C, Marchese R, Kock N, Schule B, Hiller A, Lohnau T, Winkler S, Wiegers K, Hering R, Bauer P, Riess O, Abbruzzese G, Martinelli P, Pramstaller PP: PINK1, Parkin, and DJ-1 mutations in Italian patients with early-onset parkinsonism. Eur J Hum Genet 2005. Groen JL, Kawarai T, Toulina A, Rivoiro C, Salehi-Rad S, Sato C, Morgan A, Liang Y, Postuma RB, St George-Hyslop P, Lang AE, Rogaeva E: Genetic association study of PINK1 coding polymorphisms in Parkinson's disease. Neurosci Lett 2004, 372:226-229. Healy DG, Abou-Sleiman PM, Ahmadi KR, Muqit MM, Bhatia KP, Quinn NP, Lees AJ, Latchmann DS, Goldstein DB, Wood NW: The gene responsible for PARK6 Parkinson's disease, PINK1, does not influence common forms of parkinsonism. Ann Neurol 2004, 56:329-335. http://www.jnrbm.com/content/4/1/10 15. 16. 17. 18. 19. Kurz M, Alves G, Aarsland D, Larsen JP: Familial Parkinson's disease: a community-based study. European Journal of Neurology 2003, 10:159-163. Tandberg E, Larsen JP, Nessler EG, Riise T, Aarli JA: The epidemiology of Parkinson's disease in the county of Rogaland, Norway. Movement Disorders 1995, 10:541-549. Larsen JP, Dupont E, Tandberg E: Clinical diagnosis of Parkinson's disease. Proposal of diagnostic subgroups classified at different levels of confidence. Acta Neurologica Scandinavica 1994, 89:242-251. Hughes AJ, Daniel SE, Kilford L, Lees AJ: Accuracy of clinical diagnosis of idiopathic Parkinson's disease: a clinico-pathological study of 100 cases. J Neurol Neurosurg Psychiatry 1992, 55:181-184. Jaeckel S, Epplen JT, Kauth M, Miterski B, Tschentscher F, Epplen C: Polymerase chain reaction-single strand conformation polymorphism or how to detect reliably and efficiently each sequence variation in many samples and many genes. Electrophoresis 1998, 19:3055-3061. Publish with Bio Med Central and every scientist can read your work free of charge "BioMed Central will be the most significant development for disseminating the results of biomedical researc h in our lifetime." Sir Paul Nurse, Cancer Research UK Your research papers will be: available free of charge to the entire biomedical community peer reviewed and published immediately upon acceptance cited in PubMed and archived on PubMed Central yours — you keep the copyright BioMedcentral Submit your manuscript here: http://www.biomedcentral.com/info/publishing_adv.asp Page 4 of 4 (page number not for citation purposes) The LRRK2 gene in Parkinson’s disease: mutation screening in patients from Germany A M Schlitter, D Woitalla, T Mueller, J T Epplen and G Dekomien J. Neurol. Neurosurg. Psychiatry 2006;77;891-892 doi:10.1136/jnnp.2005.083022 Updated information and services can be found at: http://jnnp.bmjjournals.com/cgi/content/full/77/7/891 These include: Rapid responses Email alerting service You can respond to this article at: http://jnnp.bmjjournals.com/cgi/eletter-submit/77/7/891 Receive free email alerts when new articles cite this article - sign up in the box at the top right corner of the article Notes To order reprints of this article go to: http://www.bmjjournals.com/cgi/reprintform To subscribe to Journal of Neurology, Neurosurgery, and Psychiatry go to: http://www.bmjjournals.com/subscriptions/ PostScript 891 N Amberger Department of Neurology, Charité – University Medicine Berlin, Germany M S van der Knaap Department of Child Neurology, VU University Medical Centre, Amsterdam, Netherlands R Zschenderlein Department of Neurology, Charité – University Medicine Berlin, Germany Correspondence to: Dr Gabor C Petzold, Department of Molecular and Cellular Biology, Harvard University, 16 Divinity Avenue, Cambridge, MA 02138, USA; [email protected] doi: 10.1136/jnnp.2005.078568 Competing interests: none declared References 1 Van der Knaap MS, van der Voorn P, Barkhof F, et al. A new leukoencephalopathy with brainstem and spinal cord involvement and high lactate. Ann Neurol 2003;53:252–8. 2 Serkov SV, Pronin IN, Bykova OV, et al. Five patients with a recently described novel leukoencephalopathy with brainstem and spinal cord involvement and elevated lactate. Neuropediatrics 2004;35:1–5. 3 Linnankivi T, Lundbom N, Autti T, et al. Five new cases of a recently described leukoencephalopathy with high brain lactate. Neurology 2004;63:688–92. 4 Van der Knaap MS, Valk J, eds. Magnetic resonance of myelin, myelination and myelin disorders, 2nd edition. Heidelberg: Springer, 1995. The LRRK2 gene in Parkinson’s disease: mutation screening in patients from Germany Since the identification in 2004 of mutations within the leucine-rich repeat kinase 2 (LRRK2) gene in patients with autosomal, dominantly inherited Parkinson’s disease, this gene has been the focus of research on Parkinson’s disease.1 Mutations in the LRRK2 gene and especially the common mutation G2019S may account for 1–2% of familial and 3–6% of sporadic cases of Parkinson’s disease, including those of early and late onset.2 The LRRK2 gene is situated on chromosome 12p11.2–q13.1 and encodes a large protein named dardarin. Dardarin contains several functional domains, including a leucine-rich repeat domain, WD40, renin–angiotensin system/guanosine triphosphatases and kinase domains. The presence of the leucine-rich repeat and WD40 domains suggests a role in protein–protein interaction. In addition, function was demonstrated kinase for dardarin in vitro.3 Some questions remain about the growing demand of DNA diagnostics and genetic counselling in Parkinson’s disease. Which subpopulation of patients with Parkinson’s disease harbours the highest risk of mutations in the LRRK2 gene? What is the frequency and penetrance of different LRRK2 mutations? Nine exons (exons 19, 24, 25, 29, 31, 34, 35, 38 and 41) of the LRRK2 gene were screened for sequence variations in a cohort of 120 patients (mean age at onset 56.3 years). The cohort was recruited in Germany and consisted of 10 (8%) patients with early-onset (age at onset ,45 years) and 110 (92%) patients with late-onset Parkinson’s disease. Approximately 25.8% of the patients had a family history of Parkinson’s disease. Screening was carried out by PCR, denaturating high-performance liquid chromatography and direct DNA sequencing. The ethics committee of RuhrUniversity Bochum, Bochum, Germany, approved this study. More detailed information and primer sequences are available from the authors upon request. Several common exonic (G1624G, K1637K, S1647T) exchanges and intronic singlenucleotide polymorphisms (Ivs33-31T.C, Ivs34+32A.G, Ivs34-51A.T, Ivs35+23T.A, Ivs38+35G.A) were identified. Of three (2.5%) patients who carried mutations in heterozygous state, two harboured the common mutation G2019S (age at onset 30 and 44 years) and one patient showed a novel mutation A1151T (age at onset 55 years). To optimise future genetic testing and counselling, we aimed at identifying patient phenotypes with the highest risk for mutations in the LRRK2 gene in Germany. The patients represent a cohort with sporadic and familial, early-onset and late-onset Parkinson’s disease. In our study, three (2.5%) patients carried LRRK2 mutations (G2019S, A1151T). This frequency may even be an underestimation of LRRK2 mutations, because our screening was limited to 9 of the 51 exons of the gene. In all, 6.7% of the patients with a family history of Parkinson’s disease and 1.1% of the patients with sporadic Parkinson’s disease are mutation carriers. Patients with early-onset Parkinson’s disease may have the highest risk for mutation in the LRRK2 gene: 2 of the 10 patients with early-onset Parkinson’s disease but only 1 of the 110 patients with late-onset Parkinson’s disease harbour a mutation. Further investigations with larger cohorts are needed to verify the observed tendencies. The novel mutation A1151T was identified in a patient with late-onset Parkinson’s disease (onset at 55 years). The patient’s mother died at the age of 68 years and her father at the age of 30 years. Thus it remains unclear whether the mutation is fully penetrant or has appeared de novo and whether the parents died before manifestation of the disease. The mutation was not observed in 336 ethnically but not age-matched control chromosomes of senior healthy blood donors from Germany. The A1151T mutation is located within the leucine-rich repeat domain (fig 1). Although the pathogenicity is not yet confirmed, conservation of the A1151 residue lends some support to the hypothesis that the A1151T exchange may be causally related to Parkinson’s disease. Onset of the disease in this patient occurred at the age of 55 years, with resting tremor in the left hand and akinesis. After a disease duration of 10 years, the patient has distinct on–off fluctuation and mild cognitive impairment. Two patients carried the common G2019S mutation in heterozygous state. The mutation was not observed in 336 ethnically matched control chromosomes of senior healthy blood donors from Germany. To date, the mutation has been found in only one of more than 4000 healthy controls of different ethnic backgrounds.4 One mutation carrier of German origin has typical, asymmetric, levadopa-responsive early-onset Parkinson’s disease (age at onset 44 years). He reported that his father had tremors. DNA and neurological examination of the patient’s father were impossible. The other mutation carrier from Belarus had early-onset Parkinson’s disease (age at onset 30 years) dominated by akinesis and rigors. Besides the early manifestation of the disease, no other atypical features were observed. In her great grandmother, Parkinson’s disease, with tremor and manifestation in her 70s, has been reported. Her mother is also a mutation carrier in heterozygous state, but remains asymptomatic (clinical examination) at 68 years. The question arises whether the mutation is incompletely penetrant or whether the manifestation is age dependent. Discordant findings in monozygotic twins favour the hypotheses of environmental modifiers.5 Taken together, our findings support the hypothesis of a complex interplay between genetic and environmental factors in the pathogenesis of Parkinson’s disease. The hypothesis of incomplete penetrance is supported by an unaffected 89-year-old with a G2019S mutation.4 Acknowledgements We thank all the participants in this study. AMS acknowledges a fellowship from the Alma and Heinrich Vogelsang Foundation. A M Schlitter Department of Human Genetics, Ruhr-University Bochum, Bochum, Germany D Woitalla, T Mueller Department of Neurology, St Josef Hospital, Ruhr-University Bochum J T Epplen, G Dekomien Department of Human Genetics, Ruhr-University Bochum Correspondence to: Gabriele Dekomien, Department of Human Genetics, Ruhr-University Bochum, 44780 Bochum, Germany; [email protected] Competing interests: none declared 2527 AA 1 LRR ROC COR MAPKKK WD40 A1151T (Exon 25) Human Rat Mouse Canis 1138 1169 NHISSLSENFLEACPKVESFSARMNFLAAMP NHIPSLSEDFLEACPKVESFSARMNFLAAMP NHIPSLPGDFLEACSKVESFSARMNFLAAMP NHITSLAEDFFEACPKVESFSARINYLAAMP Figure 1 Structure of the leucine-rich repeat kinase 2 protein and functional domains: leucine-rich repeat (LRR), renin–angiotensin system in complex (ROC) proteins, C-terminal domain of ROC (COR), mitogen-activated protein kinase kinase kinase (MAPKKK) and WD40 repeats (WD40). The position of the novel mutation A1151T (exon 25) in the LRR domain and the conservation of the alanine residue among several other vertebrate species are seen. www.jnnp.com 892 PostScript References idiopathic Parkinson’s disease. Lancet 2005;365:415–6. 3 Shen J. Protein kinases linked to the pathogenesis of Parkinson’s disease. Neuron 2004;44:575–7. 4 Kay DM, Kramer P, Higgins D, et al. Escaping Parkinson’s disease: a neurologically healthy 1 Paisan-Ruiz C, Jain S, Evans EW, et al. Cloning of the gene containing mutations that cause PARK8-linked Parkinson’s disease. Neuron 2004;44:595–600. 2 Gilks WP, Abou-Sleiman PM, Gandhi S, et al. A common LRRK2 mutation in . www.jnnp.com octogenarian with the LRRK2 G2019S mutation. Mov Disord 2005;20:1077–8. 5 Singleton AB. Altered alpha-synuclein homeostasis causing Parkinson’s disease: the potential roles of dardarin. Trends Neurosci 2005;28:416–21.
