Skript Tutorium 7

advertisement
Biochemietutorium Nr 7
Jonathan Hammer, Selina Lerch
Tutorium Nummer 7
Übersicht
Tertiärstruktur und Quartärstruktur von Proteinen


Allgemeines
Proteinfaltung: Allgemeines, Anfinsen-Experiment
Enzyme


Enzyme als Biokatalysatoren
Arrheniusgleichung
Tertitär- und Quartärstruktur
1.Wie wird vermutlich die 3D-Struktur des nachstehenden Polypeptids aussehen? Begründen Sie Ihre
Antwort!
H3N+-GTGASTIRGGLKGASSTFNQLGKNWSTVHDNVRGVEQ NVSTVSTKLKEIDNRFTKISNNGHTRGPK-CO2
H N+-GTGASTIRGGLKGASSTFNQLGKNWSTVHDNVRGVEQ NVSTVSTKLKEIDNRFTKISNNGHTRGPK-CO 3
2


Polypeptid -> weitestgehend Heptad-Repeats -> jede 1. und 4. AS ist hydrophob
Ausbildung einer α-Helix Struktur wurd dadurch stabilisiert, dass sich alle hydrophoben AS auf
derselben Seite der Helix befinden, so dass 2 Helices sich über hydrophobe Wechselwirkungen
(hydrophober Effekt) zusammenlagern. Die 3D-Struktur ist somit eine coiled-coil.“:
2. Welche Faktoren können zur Denaturierung von Proteinen führen?
3. Warum kann ein denaturiertes Ei nicht wieder renaturieren?
4. Welche fundamentale Schlussfolgerung über die Proteinfaltung hat Christian Anfinsen aus seinem
berühmten Experiment gezogen?
5. Geben Sie den Namen und chemische Strukturen der beiden Reagenzen an, welche Anfinsen zur
Denaturierung der RNAse verwendet hat.
6. Was geschieht, wenn man zunächst nur Mercaptoethanol entfernt und erst danach den Harnstoff?
(Anfinsen-Experiment)
7. Beschreiben Sie das Verfahren der Dialyse! In welchem Schritt des Anfinsen-Experiments spielt es
eine Rolle?
8. Erklären Sie warum sich Proteine trotz hoher Konzentration in der Zelle funktionell falten können?
•
Link zum Video (kleine Zusammemfassung der Proteinfaltung):
https://www.youtube.com/watch?v=nEHe3Aie9Ek
Biochemietutorium Nr 7
Jonathan Hammer, Selina Lerch
Enzyme
1. Was unterscheidet ein Enzym von herkömmlichen Katalysatoren?
2. Wie beeinflussen Enzyme die Reaktionsgeschwindigkeit (über welche Faktoren)?
Erhöhung des Frequenzfaktors A (Wahrscheinlichkeit, dass Reaktanden in richtiger
Orientierung aufeinander treffen)
Erniedrigung der Aktivierungsenergie
 siehe Arrhenius-Gleichung
3. . Wie beeinflussen Enzyme die Thermodynamik einer Reaktion?
4. Weisen Sie mit Hilfe Arrhenius-Gleichung nach, dass chemische Reaktionen beschleunigt
werden, wenn man die Temperatur erhöht.
Antwort
Biochemietutorium Nr 7
Aminosäuren der Woche




Serin
Asparagin
Asparaginsäure
Glutamin
Jonathan Hammer, Selina Lerch
Biochemietutorium Nr 7
Tabelle 1 Anhang: pKs-Werte der Aminosäuren
Jonathan Hammer, Selina Lerch
Herunterladen